Recombinant Human CRHBP protein (denatured) (ab177629)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSESRYLELREAADYDPFLLFSANLKREL AGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYD QVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRR SIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVV PHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLG GTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEY RQLEPYELENPNGNSIGEFCLSGL
    • Molecular weight
      36 kDa including tags
    • Amino acids
      22 to 322
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_001873.

Specifications

Our Abpromise guarantee covers the use of ab177629 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names
    • Corticotropin releasing factor binding protein
    • Corticotropin releasing hormone binding protein
    • CRF binding protein
    • CRF BP
    • CRFBP
    • CRH BP
    see all
  • Relevance
    CRHBP is a potent stimulator of synthesis and secretion of preopiomelanocortin derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH binding protein which inactivates CRH and which may prevent inappropriate pituitary adrenal stimulation in pregnancy.
  • Cellular localization
    Extracellular space

Images

  • 15% SDS-PAGE analysis of ab177629 (3 µg).

References

ab177629 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177629.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up