Overview

  • Product name
    Recombinant Human CRIM1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VCLPCDESKCEEPRNCPGSIVQGVCGCCYTCASQRNESCGGTFGIYGTCD RGLRCVIRPPLNGDSLTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNI INGKCECNTI
    • Amino acids
      36 to 145
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162466 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AU015004
    • CRIM 1
    • CRIM-1
    • CRIM1
    • CRIM1_HUMAN
    • Cysteine rich motor neuron 1 protein
    • Cysteine rich repeat containing protein S52
    • Cysteine rich transmembrane BMP regulator 1
    • Cysteine rich transmembrane BMP regulator 1 (chordin like)
    • Cysteine-rich motor neuron protein 1
    • Cysteine-rich repeat-containing protein S52
    • MGC138194
    • Processed cysteine rich motor neuron 1 protein
    • Processed cysteine-rich motor neuron 1 protein
    • S52
    see all
  • Function
    May play a role in CNS development by interacting with growth factors implicated in motor neuron differentiation and survival. May play a role in capillary formation and maintenance during angiogenesis. Modulates BMP activity by affecting its processing and delivery to the cell surface.
  • Tissue specificity
    Expressed in pancreas, kidney, skeletal muscle, lung, placenta, brain, heart, spleen, liver and small intestine. Expressed in blood vessels (at protein level).
  • Sequence similarities
    Contains 4 antistasin-like domains.
    Contains 1 IGFBP N-terminal domain.
    Contains 6 VWFC domains.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

Images

  • ab162466 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162466 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162466.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up