Recombinant human Cripto1 protein (Tagged) (ab190395)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHGNLYFQGGEFLGHQEFARPSRGYLAFRDDSI WPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSF YGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCD
    • Molecular weight
      17 kDa including tags
    • Amino acids
      31 to 150
    • Additional sequence information
      Full length protein without signal peptide or propeptide. Constructed with a small T7-His-TEV cleavage site Tag (29 amino acids) fusion at the N-terminal.

Specifications

Our Abpromise guarantee covers the use of ab190395 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its binding ability in a functional ELSA. Immobilized recombinant Human Nodal protein at 2µg/ml (100µl/well) can bind rhCripto-1 with a linear range of 0.5-100 ng/ml.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab190395 was refolded using a unique temperature shift inclusion body refolding technology and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, EDTA, KCl, arginine, DTT and glycerol.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • CR
    • CRGF
    • cripto
    • Cripto 1
    • Cripto 1 growth factor
    • Cripto-1 growth factor
    • Cripto1 growth factor
    • Epidermal growth factor like cripto protein CR1
    • Epidermal growth factor-like cripto protein CR1
    • TDGF 1
    • TDGF1
    • TDGF1_HUMAN
    • Teratocarcinoma derived growth factor 1
    • Teratocarcinoma-derived growth factor 1
    see all
  • Function
    Could play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm.
  • Tissue specificity
    Preferentially expressed in gastric and colorectal carcinomas than in their normal counterparts.
  • Sequence similarities
    Contains 1 EGF-like domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

References

ab190395 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190395.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up