Recombinant Human Crk p38 protein (ab101046)

Overview

  • Product name
    Recombinant Human Crk p38 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAGNFDSEERSSWYWGRLSRQEAVALLQGQ RHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPP GVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILR QEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG MIPVPYVEKYRPASASVSALIGGR
    • Molecular weight
      25 kDa
    • Amino acids
      1 to 224
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101046 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab101046 was purified by using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • Adapter molecule crk
    • Avian sarcoma virus CT10 (v crk) oncogene homolog
    • CRK
    • CRK isoform 2
    • CRK isoform II
    • CRK_HUMAN
    • CRKII
    • FLJ38130
    • OTTHUMP00000115366
    • OTTHUMP00000198330
    • p38
    • Proto oncogene C crk
    • Proto-oncogene C-crk
    • v crk avian sarcoma virus CT10 oncogene homolog
    • v crk sarcoma virus CT10 oncogene homolog
    • v crk sarcoma virus CT10 oncogene homolog (avian)
    see all
  • Function
    The Crk-I and Crk-II forms differ in their biological activities. Crk-II has less transforming activity than Crk-I. Crk-II mediates attachment-induced MAPK8 activation, membrane ruffling and cell motility in a Rac-dependent manner. Involved in phagocytosis of apoptotic cells and cell motility via its interaction with DOCK1 and DOCK4.
  • Sequence similarities
    Belongs to the CRK family.
    Contains 1 SH2 domain.
    Contains 2 SH3 domains.
  • Domain
    The C-terminal SH3 domain function as a negative modulator for transformation and the N-terminal SH3 domain appears to function as a positive regulator for transformation.
    The SH2 domain mediates interaction with SHB.
  • Post-translational
    modifications
    Phosphorylation of Crk-II (40 kDa) gives rise to a 42 kDa form.
    Phosphorylated on Tyr-221 upon cell adhesion. Results in the negative regulation of the association with SH2- and SH3-binding partners, possibly by the formation of an intramolecular interaction of phosphorylated Tyr-221 with the SH2 domain. This leads finally to the down-regulation of the Crk signaling pathway.
  • Cellular localization
    Cytoplasm. Cell membrane. Translocated to the plasma membrane upon cell adhesion.
  • Information by UniProt

Recombinant Human Crk p38 protein images

  • ab101046, at 3 µg, analysed by 15 % SDS PAGE.

References for Recombinant Human Crk p38 protein (ab101046)

ab101046 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101046.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up