Recombinant Human Crk p38 protein (ab101046)

Overview

  • Product name
    Recombinant Human Crk p38 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAGNFDSEERSSWYWGRLSRQEAVALLQGQ RHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPP GVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILR QEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG MIPVPYVEKYRPASASVSALIGGR
    • Molecular weight
      25 kDa
    • Amino acids
      1 to 224
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101046 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab101046 was purified by using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • Adapter molecule crk
    • Avian sarcoma virus CT10 (v crk) oncogene homolog
    • CRK
    • CRK isoform 2
    • CRK isoform II
    • CRK_HUMAN
    • CRKII
    • FLJ38130
    • OTTHUMP00000115366
    • OTTHUMP00000198330
    • p38
    • Proto oncogene C crk
    • Proto-oncogene C-crk
    • v crk avian sarcoma virus CT10 oncogene homolog
    • v crk sarcoma virus CT10 oncogene homolog
    • v crk sarcoma virus CT10 oncogene homolog (avian)
    see all
  • Function
    The Crk-I and Crk-II forms differ in their biological activities. Crk-II has less transforming activity than Crk-I. Crk-II mediates attachment-induced MAPK8 activation, membrane ruffling and cell motility in a Rac-dependent manner. Involved in phagocytosis of apoptotic cells and cell motility via its interaction with DOCK1 and DOCK4.
  • Sequence similarities
    Belongs to the CRK family.
    Contains 1 SH2 domain.
    Contains 2 SH3 domains.
  • Domain
    The C-terminal SH3 domain function as a negative modulator for transformation and the N-terminal SH3 domain appears to function as a positive regulator for transformation.
    The SH2 domain mediates interaction with SHB.
  • Post-translational
    modifications
    Phosphorylation of Crk-II (40 kDa) gives rise to a 42 kDa form.
    Phosphorylated on Tyr-221 upon cell adhesion. Results in the negative regulation of the association with SH2- and SH3-binding partners, possibly by the formation of an intramolecular interaction of phosphorylated Tyr-221 with the SH2 domain. This leads finally to the down-regulation of the Crk signaling pathway.
  • Cellular localization
    Cytoplasm. Cell membrane. Translocated to the plasma membrane upon cell adhesion.
  • Information by UniProt

Images

  • ab101046, at 3 µg, analysed by 15 % SDS PAGE.

References

ab101046 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101046.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up