Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP46109
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSSARFDSSDRSAWYMGPVSRQEAQTRLQG QRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRRFKIGDQEFDH LPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPTAEDNLEYVRT LYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEK LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPL PSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVN GRKGLFPFTHVKIFDPQNPDENE
    • Molecular weight36 kDa including tags
    • Amino acids1 to 303
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116208 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab116208 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.03% DTT, 0.58% Sodium chloride

General Info

  • Alternative names
    • Crk L
    • Crk like protein
    • Crk-like protein
    • Crkl
    • CRKL_HUMAN
    • Crkol
    • HGNC:2363
    • Oncogene CrkL
    • V crk avian sarcoma virus CT10 oncogene homolog like
    • v crk sarcoma virus CT10 oncogene homolog (avian) like
    • V crk sarcoma virus CT10 oncogene homolog avian like
    see all
  • FunctionMay mediate the transduction of intracellular signals.
  • Sequence similaritiesBelongs to the CRK family.
    Contains 1 SH2 domain.
    Contains 2 SH3 domains.
  • Information by UniProt

Recombinant Human CrkL protein images

  • 15% SDS-PAGE analysis of 3 µg ab116208.

References for Recombinant Human CrkL protein (ab116208)

ab116208 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116208.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"