Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSSARFDSSDRSAWYMGPVSRQEAQTRLQG QRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRRFKIGDQEFDH LPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPTAEDNLEYVRT LYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEK LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPL PSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVN GRKGLFPFTHVKIFDPQNPDENE
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 303
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116208 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab116208 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.03% DTT, 0.58% Sodium chloride

General Info

  • Alternative names
    • Crk L
    • Crk like protein
    • Crk-like protein
    • Crkl
    • CRKL_HUMAN
    • Crkol
    • HGNC:2363
    • Oncogene CrkL
    • V crk avian sarcoma virus CT10 oncogene homolog like
    • v crk sarcoma virus CT10 oncogene homolog (avian) like
    • V crk sarcoma virus CT10 oncogene homolog avian like
    see all
  • Function
    May mediate the transduction of intracellular signals.
  • Sequence similarities
    Belongs to the CRK family.
    Contains 1 SH2 domain.
    Contains 2 SH3 domains.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab116208.

References

ab116208 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116208.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up