Overview

  • Product name
    Recombinant Human CRLF3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRGAMELEPELLLQEARENVEAAQSYRRELGHRLEGLREARRQIKESASQ TRDVLKQHFNDLKGTLGKLLDERLVTLLQEVDTIEQETIKPLDDCQKLIE HGVNTAEDLVREGEIAMLGGVGEENEKLWSFTKKASHIQLDSLPEVPLLV DVPCLSAQLDDSILNIVKDHIFKHGTVASRPPVQIEELIEKPGGIIVRWC KVDDDFTAQDYRLQFRKCTSNHFEDVYVGSETEFIVLHIDPNVDYQFRVC ARGDGRQEWSPWSVPQIGHSTLVPHEWTAGFEGYSLSSRRNIALRNDSES SGVLYSRAPTYFCGQTLTFRVETVGQPDRRDSIGVCAEKQDGYDSLQRDQ AVCISTNGAVFVNGKEMTNQLPAVTSGSTVTFDIEAVTLGTTSNNEGGHF KLRVTISSNNREVVFDWLLDQSCGSLYFGCSFFYPGWKVLVF
    • Amino acids
      1 to 442
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162534 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CREME 9
    • CREME9
    • CRLF 3
    • CRLM9
    • Cytokine receptor like factor 3
    • Cytokine receptor like molecule 9
    • Cytokine receptor related protein 4
    • CYTOR4
    • FRWS
    • MGC20661
    • P48
    • p48.2
    • Type I cytokine receptor like factor
    • Type I cytokine receptor like factor p48
    see all
  • Relevance
    CRLF3 (Cytokine receptor-like factor 3) contains one fibronectin type-III domain. It is expressed in skin and squamous cell carcinoma (SCC) and in lesion actinic keratosis (AK).
  • Cellular localization
    Cytoplasmic

Images

  • ab162534 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162534 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162534.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up