Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ16555
    • SpeciesHuman
    • SequenceMSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLI VPGGVKTIEAHSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGG TTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQE EMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAE NGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPL YITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAA FVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTL IPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGR IAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQG KIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYD GPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNI PRRTTQRIVAPPGGRANITSLG
    • Molecular weight89 kDa including tags
    • Amino acids1 to 572
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114269 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Collapsin response mediator protein
    • Collapsin response mediator protein 2
    • Collapsin response mediator protein hCRMP 2
    • CRAM
    • CRMP 2
    • CRMP-2
    • CRMP2
    • DHPRP 2
    • DHPRP2
    • Dihydropyrimidinase 2
    • Dihydropyrimidinase like 2
    • Dihydropyrimidinase like 2 long form
    • Dihydropyrimidinase related protein 2
    • Dihydropyrimidinase-related protein 2
    • DPYL 2
    • DPYL2
    • DPYL2_HUMAN
    • DPYSL 2
    • Dpysl2
    • DRP-2
    • DRP2
    • Musunc 33
    • Musunc33
    • N2A3
    • TOAD 64
    • TOAD64
    • ULIP 2 protein
    • ULIP-2
    • Ulip2
    • Unc-33-like phosphoprotein 2
    see all
  • FunctionNecessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, neuronal growth cone collapse and cell migration.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the DHOase family. Hydantoinase/dihydropyrimidinase subfamily.
  • Post-translational
    modifications
    3F4, a monoclonal antibody which strongly stains neurofibrillary tangles in Alzheimer disease brains, specifically labels DPYSL2 when phosphorylated on Ser-518, Ser-522 and Thr-509.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human CRMP2 protein images

  • 12.5% SDS-PAGE analysis of ab114269.
    Stained with Coomassie Blue.

References for Recombinant Human CRMP2 protein (ab114269)

ab114269 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114269.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"