Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLI VPGGVKTIEAHSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGG TTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQE EMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAE NGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPL YITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAA FVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTL IPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGR IAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQG KIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYD GPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNI PRRTTQRIVAPPGGRANITSLG
    • Molecular weight
      89 kDa including tags
    • Amino acids
      1 to 572
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114269 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Collapsin response mediator protein
    • Collapsin response mediator protein 2
    • Collapsin response mediator protein hCRMP 2
    • CRAM
    • CRMP 2
    • CRMP-2
    • CRMP2
    • DHPRP 2
    • DHPRP2
    • Dihydropyrimidinase 2
    • Dihydropyrimidinase like 2
    • Dihydropyrimidinase like 2 long form
    • Dihydropyrimidinase related protein 2
    • Dihydropyrimidinase-related protein 2
    • DPYL 2
    • DPYL2
    • DPYL2_HUMAN
    • DPYSL 2
    • Dpysl2
    • DRP-2
    • DRP2
    • Musunc 33
    • Musunc33
    • N2A3
    • TOAD 64
    • TOAD64
    • ULIP 2 protein
    • ULIP-2
    • Ulip2
    • Unc-33-like phosphoprotein 2
    see all
  • Function
    Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, neuronal growth cone collapse and cell migration.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the DHOase family. Hydantoinase/dihydropyrimidinase subfamily.
  • Post-translational
    modifications
    3F4, a monoclonal antibody which strongly stains neurofibrillary tangles in Alzheimer disease brains, specifically labels DPYSL2 when phosphorylated on Ser-518, Ser-522 and Thr-509.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab114269.
    Stained with Coomassie Blue.

References

ab114269 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114269.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up