Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SFPDTVYKKLVQREKTLKVRGVDRTPYLGDVAVVVHPGKKEMGTPLADTP TRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRSSGIW
    • Amino acids
      466 to 564
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163416 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Collapsin response mediator protein 5
    • CRAM
    • CRMP 3 associated molecule
    • CRMP 5
    • CRMP3 associated molecule
    • Dihydropyrimidinase like 5
    • Dihydropyrimidinase related protein 5
    • Dihydropyrimidinase-related protein 5
    • DPYL5_HUMAN
    • DPYS L5
    • DPYSL 5
    • DPYSL5
    • DRP 5
    • DRP5
    • FLJ45383
    • Ulip 6
    • Ulip6
    • ULIP6 protein
    • UNC33-like phosphoprotein 6
    see all
  • Information by UniProt

Images

  • ab163416 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163416 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163416.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up