Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTN TRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRI RRGHARLALS
    • Amino acids
      1 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162656 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • cAMP regulatory element-associated protein 1
    • Cisplatin resistance-associated overexpressed protein
    • Cisplatin resistance-associated-overexpressed protein
    • CRA
    • CRE-associated protein 1
    • CREAP-1
    • CREAP1
    • CROP
    • hLuc7A
    • LC7L3_HUMAN
    • LUC7 like 3 pre mRNA splicing factor
    • Luc7-like protein 3
    • Luc7A
    • LUC7L3
    • O48
    • OA48 18
    • Okadaic acid-inducible phosphoprotein OA48-18
    see all
  • Function
    Binds cAMP regulatory element DNA sequence. May play a role in RNA splicing.
  • Tissue specificity
    Widely expressed. Highest levels in heart, brain, pancreas, thymus, ovary, small intestine and peripheral blood leukocytes, as well as cerebellum, putamen and pituitary gland. Lowest levels in lung, liver and kidney. Also expressed in fetal tissues, including brain, heart, kidney, thymus and lung.
  • Sequence similarities
    Belongs to the Luc7 family.
  • Post-translational
    modifications
    Phosphorylated in vitro by SRPK1, SRPK2 and CLK1.
  • Cellular localization
    Nucleus speckle. The subnuclear localization is affected by cisplatin.
  • Information by UniProt

Images

  • ab162656 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162656 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162656.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up