Recombinant Human CRSP8 protein (denatured) (ab180327)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMADVINVSVNLEAFSQAISAIQALRSS VSRVFDCLKDGMRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLV GKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASGL LNQQSLKRSANQMGVSAKRRPKAQPTTLVLPPQYVDDVISRIDRMFPEMS IHLSRPNGTSAMLLVTLGKVLKVIVVMRSLFIDRTIVKGYNENVYTEDGK LDIWSKSNYQVFQKVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLF QAPCQRCGKFLQDGLPPTWRDFRTLEAFHDTCRQ
    • Molecular weight
      38 kDa including tags
    • Amino acids
      1 to 311
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_004260

Specifications

Our Abpromise guarantee covers the use of ab180327 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 80 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 10% Glycerol, 2.4% Urea, 0.32% Tris HCl

General Info

  • Alternative names
    • Cofactor required for Sp1 transcriptional activation subunit 8
    • Cofactor required for Sp1 transcriptional activation subunit 8 (34kD)
    • Cofactor required for Sp1 transcriptional activation subunit 8 34kDa
    • CRAP 34
    • CRAP34
    • CRSP 34
    • CRSP 8
    • CRSP complex subunit 8
    • CRSP34
    • CRSP8
    • MED 27
    • Med27
    • MED27_HUMAN
    • Mediator complex subunit 27
    • Mediator of RNA polymerase II transcription subunit 27
    • MGC11274
    • P37 TRAP/SMCC/PC2 subunit
    • Transcriptional coactivator CRSP34
    • TRAP 37
    • TRAP37
    see all
  • Function
    Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
  • Sequence similarities
    Belongs to the Mediator complex subunit 27 family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab180327.

References

ab180327 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180327.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up