Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQ CDD LIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIR SPGSIKRE EKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQR LETAERFQKHLER VIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDS NNCTGQNEHQRENSGHRR DQIIEKDAALCVLIDEMNERP

Associated products

Specifications

Our Abpromise guarantee covers the use of ab88638 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab88638 was purified using affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • Activator recruited cofactor 34 kDa component
    • Activator-recruited cofactor 34 kDa component
    • ARC34
    • Cofactor required for Sp1 transcriptional activation subunit 9
    • Cofactor required for Sp1 transcriptional activation, subunit 9 (33kD)
    • Cofactor required for Sp1 transcriptional activation, subunit 9, 33kDa
    • CRSP complex subunit 9
    • CRSP33
    • CRSP9
    • hMED7
    • MED7
    • MED7_HUMAN
    • Mediator complex subunit 7
    • Mediator of RNA polymerase II transcription subunit 7
    • MGC12284
    • RNA polymerase transcriptional regulation mediator subunit 7 homolog
    • Transcriptional coactivator CRSP33
    see all
  • FunctionComponent of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
  • Sequence similaritiesBelongs to the Mediator complex subunit 7 family.
  • Post-translational
    modifications
    Constitutively sumoylated.
  • Cellular localizationNucleus.
  • Information by UniProt

References for Recombinant Human CRSP9 protein (ab88638)

ab88638 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88638.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"