Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MWWRVLSLLAWFPLQEASLTNHTETITVEEGQTLTLKCVTSLRKNSSLQW LTPSGFTIFLNEYPVLKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLH YSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPP QITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRH RGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTED SSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKSGILLLTLVSFLIFI LFIIVQLFIMKLRKTHVIWKKENEVSEHTLESYRSRSNNEETSSEEKNGQ SSHPMRCMNYITKLYSEGKTKRKENVQHSKLEEKHIQVPESIV
    • Amino acids
      1 to 393
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163368 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD355
    • Class I MHC restricted T cell associated molecule
    • Class-I MHC-restricted T-cell-associated molecule
    • CRTAM
    • CRTAM_HUMAN
    • Cytotoxic and regulatory T cell molecule
    • Cytotoxic and regulatory T-cell molecule
    see all
  • Function
    Interaction with CADM1 promotes natural killer (NK) cell cytotoxicity and interferon-gamma (IFN-gamma) secretion by CD8+ cells in vitro as well as NK cell-mediated rejection of tumors expressing CADM3 in vivo.
  • Tissue specificity
    In the immune system, expression is restricted to activated class-I MHC-restricted cells, including NKT and CD8 cells. Strongly expressed in spleen, thymus, small intestine, peripheral blood leukocyte, and in Purkinje neurons in cerebellum. Expressed at much lower levels in testis, ovary, colon, lung and lymphoid tissues.
  • Sequence similarities
    Belongs to the nectin family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab163368 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163368 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163368.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up