Overview

  • Product name
    Recombinant Human CRTR1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLFWHTQPEHYNQHNSGSYLRDVLALPIFKQEEPQLSPENEARLPPLQYV LCAATSPAVKLHEETLTYLNQGQSYEIRLLENRKLGDFQDLNTKYVKSII RVVFHDRRLQYTEHQQLEGWRWSRPGDRILDIDIPLSVGILDPRASPTQL NAVEFLWDPAKRASAFIQVHCISTEFTPRKHGGEKGVPFRVQIDTFKQNE NGEYTEHLHSASCQIKVFKPKGADRKQKTDREKMEKRTAQEKEKYQPSYE TTILTECSPWPDVAYQVNSAPSPSYNGSPNSFGLGEGNASPTHPVEALPV GSDHLLPSASIQDAQQWLHRNRFSQFCRLFASFSGADLLKMSRDDLVQIC GPADGIRLFNAIKGRNVRPKMTIYVCQELEQNRVPLQQKRDGSGDSNLSV YHAIFLEELTTLELIEKIANLYSISPQHIHRVYRQGPTGIHVVVSNEMVQ NFQDESCFVLSTIKAESNDGYHIILKCGL
    • Amino acids
      1 to 479
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162242 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CP2 related transcriptional repressor 1
    • CP2-related transcriptional repressor 1
    • CRTR 1
    • CRTR-1
    • LBP 9
    • LBP9
    • TF2L1_HUMAN
    • TFCP2 L1
    • TFCP2L1
    • Transcription factor CP2 like 1
    • Transcription factor CP2 like protein 1
    • Transcription factor CP2-like protein 1
    • Transcription factor LBP 9
    • Transcription factor LBP-9
    • Transcription factor LBP9
    see all
  • Function
    Transcriptional suppressor. May suppress UBP1-mediated transcriptional activation. Modulates the placental expression of CYP11A1.
  • Tissue specificity
    Highly expressed in placental JEG-3 cells and very low levels of expression in non-steroidogenic cells. No expression was seen in adrenal NCI-H295A cells or in adrenal tissue.
  • Sequence similarities
    Belongs to the grh/CP2 family. CP2 subfamily.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab162242 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162242 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162242.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up