Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRMELPKKPVGLVT SQQMESCRAEIQENHDETYGVPSLEELGFPTEGLGPAVWQG
    • Molecular weight
      36 kDa including tags
    • Amino acids
      141 to 231

Specifications

Our Abpromise guarantee covers the use of ab114947 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • cry2
    • CRY2_HUMAN
    • Cryptochrome 2
    • cryptochrome 2 (photolyase like)
    • Cryptochrome-2
    • FLJ10332
    • growth inhibiting protein 37
    • HCRY2
    • KIAA0658
    • PHLL2
    • Photolyase like
    see all
  • Function
    Blue light-dependent regulator of the circadian feedback loop. Inhibits CLOCK
    NPAS2-ARNTL E box-mediated transcription. Acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. Has no photolyase activity. Capable of translocating circadian clock core proteins such as PER proteins to the nucleus. May inhibit CLOCK
    NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL.
  • Tissue specificity
    Expressed in all tissues examined including fetal brain, fibroblasts, heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon and leukocytes. Highest levels in heart and skeletal muscle.
  • Sequence similarities
    Belongs to the DNA photolyase class-1 family.
    Contains 1 DNA photolyase domain.
  • Post-translational
    modifications
    Phosphorylation on Ser-266 by MAPK is important for the inhibition of CLOCK-ARNTL-mediated transcriptional activity. Phosphorylation by CSKNE requires interaction with PER1 or PER2.
    Ubiquitinated by the SCF(FBXL3) and SCF(FBXL21) complex, leading to its degradation.
  • Cellular localization
    Cytoplasm. Nucleus. Translocated to the nucleus through interaction with other Clock proteins such as PER2 or ARNTL.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114947 at approximately 35.64kDa.
    Stained with Coomassie Blue.

References

ab114947 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114947.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up