Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ49AN0
    • SpeciesHuman
    • SequenceVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRMELPKKPVGLVT SQQMESCRAEIQENHDETYGVPSLEELGFPTEGLGPAVWQG
    • Molecular weight36 kDa including tags
    • Amino acids141 to 231

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114947 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • cry2
    • CRY2_HUMAN
    • Cryptochrome 2
    • cryptochrome 2 (photolyase like)
    • Cryptochrome-2
    • FLJ10332
    • growth inhibiting protein 37
    • HCRY2
    • KIAA0658
    • PHLL2
    • Photolyase like
    see all
  • FunctionBlue light-dependent regulator of the circadian feedback loop. Inhibits CLOCK
    NPAS2-ARNTL E box-mediated transcription. Acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. Has no photolyase activity. Capable of translocating circadian clock core proteins such as PER proteins to the nucleus. May inhibit CLOCK
    NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL.
  • Tissue specificityExpressed in all tissues examined including fetal brain, fibroblasts, heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon and leukocytes. Highest levels in heart and skeletal muscle.
  • Sequence similaritiesBelongs to the DNA photolyase class-1 family.
    Contains 1 DNA photolyase domain.
  • Post-translational
    modifications
    Phosphorylation on Ser-266 by MAPK is important for the inhibition of CLOCK-ARNTL-mediated transcriptional activity. Phosphorylation by CSKNE requires interaction with PER1 or PER2.
    Ubiquitinated by the SCF(FBXL3) and SCF(FBXL21) complex, leading to its degradation.
  • Cellular localizationCytoplasm. Nucleus. Translocated to the nucleus through interaction with other Clock proteins such as PER2 or ARNTL.
  • Information by UniProt

Recombinant Human CRY2 protein images

  • 12.5% SDS-PAGE showing ab114947 at approximately 35.64kDa.
    Stained with Coomassie Blue.

References for Recombinant Human CRY2 protein (ab114947)

ab114947 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114947.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"