Recombinant Human CRYZL1 protein (ab116465)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO95825
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMKGLYFQQSSTDEEITFVFQEKEDLPVTED NFVKLQVKACALSQINTKLLAEMKMKKDLFPVGREIAGIVLDVGSKVSFF QPDDEVVGILPLDSEDPGLCEVVRVHEHYLVHKPEKVTWTEAAGSIRDGV RAYTALHYLSHLSPGKSVLIMDGASAFGTIAIQLAHHRGAKVISTACSLE DKQCLERFRPPIARVIDVSNGKVHVAESCLEETGGLGVDIVLDAGVRLYS KDDEPAVKLQLLPHKHDIITLLGVGGHWVTTEENLQLDPPDSHCLFLKGA TLAFLNDEVWNLSNVQQGKYLCILKDVMEKLSTGVFRPQLDEPIPLYEAK VSMEAVQKNQGRKKQVVQF
    • Molecular weight41 kDa including tags
    • Amino acids1 to 349
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116465 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    ab116465 is purified by proprietary chromatographic techniques and filter sterilized.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.03% DTT, 0.58% Sodium chloride

General Info

  • Alternative names
    • 4P11
    • Crystallin zeta (quinone reductase) like 1
    • CRYZL1
    • Protein 4P11
    • QOH 1
    • QOH-1
    • QOH1
    • QORL1_HUMAN
    • Quinone oxidoreductase homolog 1
    • Quinone oxidoreductase like 1
    • Quinone oxidoreductase-like protein 1
    • Quinone reductase like 1
    • Zeta crystallin homolog
    • Zeta-crystallin homolog
    see all
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily.
  • Information by UniProt

References for Recombinant Human CRYZL1 protein (ab116465)

ab116465 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116465.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"