Recombinant Human CRYZL1 protein (ab116465)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMKGLYFQQSSTDEEITFVFQEKEDLPVTED NFVKLQVKACALSQINTKLLAEMKMKKDLFPVGREIAGIVLDVGSKVSFF QPDDEVVGILPLDSEDPGLCEVVRVHEHYLVHKPEKVTWTEAAGSIRDGV RAYTALHYLSHLSPGKSVLIMDGASAFGTIAIQLAHHRGAKVISTACSLE DKQCLERFRPPIARVIDVSNGKVHVAESCLEETGGLGVDIVLDAGVRLYS KDDEPAVKLQLLPHKHDIITLLGVGGHWVTTEENLQLDPPDSHCLFLKGA TLAFLNDEVWNLSNVQQGKYLCILKDVMEKLSTGVFRPQLDEPIPLYEAK VSMEAVQKNQGRKKQVVQF
    • Molecular weight
      41 kDa including tags
    • Amino acids
      1 to 349
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116465 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    ab116465 is purified by proprietary chromatographic techniques and filter sterilized.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.03% DTT, 0.58% Sodium chloride

General Info

  • Alternative names
    • 4P11
    • Crystallin zeta (quinone reductase) like 1
    • CRYZL1
    • Protein 4P11
    • QOH 1
    • QOH-1
    • QOH1
    • QORL1_HUMAN
    • Quinone oxidoreductase homolog 1
    • Quinone oxidoreductase like 1
    • Quinone oxidoreductase-like protein 1
    • Quinone reductase like 1
    • Zeta crystallin homolog
    • Zeta-crystallin homolog
    see all
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily.
  • Information by UniProt

References

ab116465 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116465.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up