Recombinant Human CSAG1 protein (BSA and azide free) (ab180304)

Overview

  • Product name
    Recombinant Human CSAG1 protein (BSA and azide free)
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSDQVDWSRLYRDTGLVKMSRKPRASSPF SNNHPSTPKRFPRQPKREKGPVKEVPGTKGSP
    • Molecular weight
      9 kDa including tags
    • Amino acids
      20 to 78
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_001096046.1

Specifications

Our Abpromise guarantee covers the use of ab180304 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.
    ab180304 was purified by using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride, 10% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • Cancer/testis antigen 24.1
    • Cancer/testis antigen CSAGE
    • Cancer/testis antigen family 24, member 1
    • Chondrosarcoma associated gene 1
    • CSAG1
    • CSAGE
    • CT24.1
    • Putative chondrosarcoma-associated gene 1 protein
    see all
  • Relevance
    This gene encodes a member of a family of tumor antigens. The protein is expressed in chondrosarcomas, but may also be expressed in normal tissues such as testis. Alternative splicing of this gene results in two transcript variants encoding the same protein.
  • Cellular localization
    Expressed in chondrosarcoma, melanoma, cartilage and testis, but not in other normal tissues.

Images

  • 15% SDS-PAGE analysis of ab180304 (3 µg).

References

ab180304 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180304.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up