Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLP TKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSD IEGEYVPVEGDEVTYKMCPIPPKNQKFQAVEVVLTQLAPHTPHETWSGQV VGS
    • Amino acids
      1 to 153
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162128 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cold shock domain containing C2 RNA binding
    • Cold shock domain containing protein C2
    • Cold shock domain-containing protein C2
    • CSDC 2
    • Csdc2
    • CSDC2_HUMAN
    • dJ347H13.2
    • PIPPIN
    • RNA binding protein PIPPin
    • RNA-binding protein PIPPin
    see all
  • Function
    RNA-binding factor which binds specifically to the very 3'-UTR ends of both histone H1 and H3.3 mRNAs, encompassing the polyadenylation signal. Might play a central role in the negative regulation of histone variant synthesis in the developing brain.
  • Sequence similarities
    Contains 1 CSD (cold-shock) domain.
  • Cellular localization
    Nucleus. Cytoplasm. PIPPin-RNA complexes are located to the nucleus.
  • Information by UniProt

Images

  • ab162128 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162128 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162128.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up