Recombinant Human CSGALNACT2 protein (ab163095)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPRRGLILHTRTHWLLLGLALLCSLVLFMYLLECAPQTDGNASLPGVVGE NYGKEYYQALLQEQEEHYQTRATSLKRQIAQLKQELQEMSEKMRSLQERR NVGANGIGYQSNKEQAPSDLLEFLHSQIDKAEVSIGAKLPSEYGVIPFES FTLMKVFQLEMGLTRHPEEKPVRKDKRDELVEVIEAGLEVINNPDEDDEQ EDEEGPLGEKLIFNENDFVEGYYRTERDKGTQYELFFKKADLTEYRHVTL FRPFGPLMKVKSEMIDITRSIINIIVPLAERTEAFVQFMQNFRDVCIHQD KKIHLTVVYFGKEGLSKVKSILESVTSESNFHNYTLVSLNEEFNRGRGLN VGARAWDKGEVLMFFCDVDIYFSAEFLNSCRLNAEPGKKVFYPVVFSLYN PAIVYANQEVPPPVEQQLVHKKDSGFWRDFGFGMTCQYRSDFLTIGGFDM EVKGWGGEDVHLYRKYLHGDLIVIRTPVPGLFHLWHEKRCADELTPEQYR MCIQSKAMNEAPHSHLGMLVFREEIETHLHKQAYRTNSEAVG
    • Amino acids
      1 to 542
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163095 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4-N-acetylgalactosaminyltransferase 2
    • Beta4GalNAcT-2
    • CGAT2_HUMAN
    • CHGN2
    • Chondroitin beta-1
    • Chondroitin sulfate N-acetylgalactosaminyltransferase 2
    • Csgalnact2
    • DKFZp686H13226
    • FLJ43310
    • GALNACT 2
    • GalNAcT-2
    • GALNACT2
    • MGC40204
    • PRO0082
    see all
  • Function
    Transfers 1,4-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of glucuronic acid (GlcUA). Required for addition of the first GalNAc to the core tetrasaccharide linker and for elongation of chondroitin chains.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the chondroitin N-acetylgalactosaminyltransferase family.
  • Cellular localization
    Golgi apparatus > Golgi stack membrane.
  • Information by UniProt

Images

  • ab163095 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163095 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163095.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up