Recombinant Human CSGLCAT protein (ab162753)

Overview

  • Product name
    Recombinant Human CSGLCAT protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRLSSLLALLRPALPLILGLSLGCSLSLLRVSWIQGEGEDPCVEAVGERG GPQNPDSRARLDQSDEDFKPRIVPYYRDPNKPYKKVLRTRYIQTELGSRE RLLVAVLTSRATLSTLAVAVNRTVAHHFPRLLYFTGQRGARAPAGMQVVS HGDERPAWLMSETLRHLHTHFGADYDWFFIMQDDTYVQAPRLAALAGHLS INQDLYLGRAEEFIGAGEQARYCHGGFGYLLSRSLLLRLRPHLDGCRGDI LSARPDEWLGRCLIDSLGVGCVSQHQGQQYRSFELAKNRDPEKEGSSAFL SAFAVHPVSEGTLMYRLHKRFSALELERAYSEIEQLQAQIRNLTVLTPEG EAGLSWPVGLPAPFTPHSRFEVLGWDYFTEQHTFSCADGAPKCPLQGASR ADVGDALETALEQLNRRYQPRLRFQKQRLLNGYRRFDPARGMEYTLDLLL ECVTQRGHRRALARRVSLLRPLSRVEILPMPYVTEATRVQLVLPLLVAEA AAAPAFLEAFAANVLEPREHALLTLLLVYGPREGGRGAPDPFLGVKAAAA ELERRYPGTRLAWLAVRAEAPSQVRLMDVVSKKHPVDTLFFLTTVWTRPG PEVLNRCRMNAISGWQAFFPVHFQEFNPALSPQRSPPGPPGAGPDPPSPP GADPSRGAPIGGRFDRQASAEGCFYNADYLAARARLAGELAGQEEEEALE GLEVMDVFLRFSGLHLFRAVEPGLVQKFSLRDCSPRLSEELYHRCRLSNL EGLGGRAQLAMALFEQEQANST
    • Amino acids
      1 to 772
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162753 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Chondroitin glucuronyltransferase
    • Chondroitin polymerizing factor 2
    • Chondroitin sulfate glucuronyltransferase
    • Chondroitin synthase 3
    • ChPF-2
    • CHPF2
    • CHPF2_HUMAN
    • ChSy 3
    • ChSy-3
    • CSGLCA T
    • CSGlcA-T
    • N acetylgalactosaminyl proteoglycan 3 beta glucuronosyltransferase
    • N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase
    see all
  • Function
    Transfers glucuronic acid (GlcUA) from UDP-GlcUA to N-acetylgalactosamine residues on the non-reducing end of the elongating chondroitin polymer. Has no N-acetylgalactosaminyltransferase activity.
  • Tissue specificity
    Ubiquitous. Highly expressed in placenta, small intestine and pancreas.
  • Sequence similarities
    Belongs to the chondroitin N-acetylgalactosaminyltransferase family.
  • Cellular localization
    Golgi apparatus > Golgi stack membrane.
  • Information by UniProt

Images

  • ab162753 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162753 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162753.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up