Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDN PEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFV LSSWWAKALFVFCGLLTCCYCCCCLCCCFNCCCGKCKPKAPEGEETEFYV SPEDLEAQLQSDEREATDTPIVIQPASATETTQLTADSHPSYHTDGFN
    • Amino acids
      1 to 198
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164259 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CLN 4
    • CLN4
    • CLN4B
    • CSP
    • Cysteine string protein
    • cysteine string protein alpha
    • DJC5
    • DnaJ (Hsp40) homolog subfamily C member 5
    • DnaJ homolog subfamily C member 5
    • DNAJC 5
    • Dnajc5
    • DNAJC5A
    • DNJC5_HUMAN
    • NCL
    see all
  • Function
    May have an important role in presynaptic function. May be involved in calcium-dependent neurotransmitter release at nerve endings.
  • Tissue specificity
    Expressed in pancreas, kidney, skeletal muscle, liver, lung, placenta, brain and heart.
  • Sequence similarities
    Contains 1 J domain.
  • Post-translational
    modifications
    Fatty acylated. Heavily palmitoylated in the cysteine string motif.
  • Cellular localization
    Membrane. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Images

  • ab164259 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164259 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164259.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up