Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP21291
    • SpeciesHuman
    • SequenceEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKAC FRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHS
    • Molecular weight37 kDa including tags
    • Amino acids94 to 192

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114650 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CRP
    • CRP 1
    • CRP1
    • CSRP
    • CSRP 1
    • CSRP1
    • CSRP1_HUMAN
    • CYRP
    • Cysteine and glycine rich protein 1
    • Cysteine and glycine-rich protein 1
    • Cysteine rich protein
    • Cysteine rich protein 1
    • Cysteine-rich protein 1
    • D1S181E
    • DKFZp686M148
    • Epididymis luminal protein 141
    • Epididymis secretory protein Li 286
    • HEL 141
    • HEL S 286
    • LIM domain protein
    see all
  • FunctionCould play a role in neuronal development.
  • Sequence similaritiesContains 2 LIM zinc-binding domains.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human CSRP1 protein images

  • ab114650 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human CSRP1 protein (ab114650)

ab114650 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114650.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"