Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKAC FRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHS
    • Molecular weight
      37 kDa including tags
    • Amino acids
      94 to 192

Specifications

Our Abpromise guarantee covers the use of ab114650 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CRP
    • CRP 1
    • CRP1
    • CSRP
    • CSRP 1
    • CSRP1
    • CSRP1_HUMAN
    • CYRP
    • Cysteine and glycine rich protein 1
    • Cysteine and glycine-rich protein 1
    • Cysteine rich protein
    • Cysteine rich protein 1
    • Cysteine-rich protein 1
    • D1S181E
    • DKFZp686M148
    • Epididymis luminal protein 141
    • Epididymis secretory protein Li 286
    • HEL 141
    • HEL S 286
    • LIM domain protein
    see all
  • Function
    Could play a role in neuronal development.
  • Sequence similarities
    Contains 2 LIM zinc-binding domains.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab114650 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114650 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114650.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up