Recombinant Human CSRP2BP protein (ab163533)

Overview

  • Product name
    Recombinant Human CSRP2BP protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDSSIHLSSLISRHDDEATRTSTSEGLEEGEVEGETLLIVESEDQASVDL SHDQSGDSLNSDEGDVSWMEEQLSYFCDKCQKWIPASQLREQLSYLKGDN FFRFTCSDCSADGKEQYERLKLTWQQVVMLAMYNLSLEGSGRQGYFRWKE DICAFIEKHWTFLLGNRKKTSTWWSTVAGCLSVGSPMYFRSGAQEFGEPG WWKLVHNKPPTMKPEGEKLSASTLKIKAASKPTLDPIITVEGLRKRASRN PVESAMELKEKRSRTQEAKDIRRAQKEAAGFLDRSTSSTPVKFISRGRRP DVILEKGEVIDFSSLSSSDRTPLTSPSPSPSLDFSAPGTPASHSATPSLL SEADLIPDVMPPQALFHDDDEMEGDGVIDPGMEYVPPPAGSVASGPVVGG RKKVRGPEQIKQEVESEEEKPDRMDIDSEDTDSNTSLQTRAREKRKPQLE KDTKPKEPRYTPVSIYEEKLLLKRLEACPGAVAMTPEARRLKRKLIVRQA KRDRGLPLFDLDQVVNAALLLVDGIYGAKEGGISRLPAGQATYRTTCQDF RILDRYQTSLPSRKGFRHQTTKFLYRLVGSEDMAVDQSIVSPYTSRILKP YIRRDYETKPPKLQLLSQIRSHLHRSDPHWTPEPDAPLDYCYVRPNHIPT INSMCQEFFWPGIDLSECLQYPDFSVVVLYKKVIIAFGFMVPDVKYNEAY ISFLFVHPEWRRAGIATFMIYHLIQTCMGKDVTLHVSASNPAMLLYQKFG FKTEEYVLDFYDKYYPLESTECKHAFFLRLRR
    • Amino acids
      1 to 782
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163533 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADA2A containing complex subunit 2
    • ADA2A-containing complex subunit 2
    • ATAC2
    • CRP2 binding partner
    • CRP2-binding partner
    • CRP2BP
    • CSR2B_HUMAN
    • CSRP2 binding protein
    • CSRP2-binding protein
    • Csrp2bp
    • Cysteine rich protein 2 binding protein
    • Cysteine-rich protein 2-binding protein
    see all
  • Function
    Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4. May function as a scaffold for the ATAC complex to promote ATAC complex stability. Has also weak histone acetyltransferase activity toward histone H4. Required for the normal progression through G1 and G2/M phases of the cell cycle.
  • Tissue specificity
    Expressed in skeletal muscle, heart, lung, placenta, brain, liver, pancreas and kidney. High expression in skeletal muscle and heart. Lower expression in lung.
  • Sequence similarities
    Contains 1 N-acetyltransferase domain.
  • Cellular localization
    Nucleus. Cytoplasm. Mainly nuclear.
  • Information by UniProt

Images

  • ab163533 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163533 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163533.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up