Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ15828
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMRPQERMVGELRDLSPDDPQVQKAAQAAVA SYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDH VDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM
    • Molecular weight16 kDa including tags
    • Amino acids29 to 149
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109966 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab109966 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • CST 6
    • CST6
    • Cystatin 6
    • Cystatin E
    • Cystatin E/M
    • Cystatin M
    • Cystatin M/E
    • Cystatin-6
    • Cystatin-E
    • Cystatin-M
    • Cystatin6
    • CystatinE
    • CystatinM
    • Cysteine proteinase inhibitor
    • CYTM_HUMAN
    see all
  • FunctionShows moderate inhibition of cathepsin B but is not active against cathepsin C.
  • Tissue specificityRestricted to the stratum granulosum of normal skin, the stratum granulosum/spinosum of psoriatic skin, and the secretory coils of eccrine sweat glands. Low expression levels are found in the nasal cavity.
  • Sequence similaritiesBelongs to the cystatin family.
  • Post-translational
    modifications
    Substrate for transglutaminases. Acts as an acyl acceptor but not as an acyl donor.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human CST6 protein images

  • 15% SDS-PAGE analysis of 3µg ab109966.

References for Recombinant Human CST6 protein (ab109966)

ab109966 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109966.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"