Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQ SQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDF EVLVVPWQNSSQLLKHNCVQMLEHHHHHH
    • Molecular weight
      15 kDa including tags
    • Amino acids
      29 to 149
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151356 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 5.50
    Constituents: 0.39% MES, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names
    • CST 6
    • CST6
    • Cystatin 6
    • Cystatin E
    • Cystatin E/M
    • Cystatin M
    • Cystatin M/E
    • Cystatin-6
    • Cystatin-E
    • Cystatin-M
    • Cystatin6
    • CystatinE
    • CystatinM
    • Cysteine proteinase inhibitor
    • CYTM_HUMAN
    see all
  • Function
    Shows moderate inhibition of cathepsin B but is not active against cathepsin C.
  • Tissue specificity
    Restricted to the stratum granulosum of normal skin, the stratum granulosum/spinosum of psoriatic skin, and the secretory coils of eccrine sweat glands. Low expression levels are found in the nasal cavity.
  • Sequence similarities
    Belongs to the cystatin family.
  • Post-translational
    modifications
    Substrate for transglutaminases. Acts as an acyl acceptor but not as an acyl donor.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab151356 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151356.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up