Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQEYNKESEDKYVFLVVKTLQAQLQVTNLLEYLIDVEIARSDCRKPLSTN EICAIQENSKLKRKLSCSFLVGALPWNGEFTVMEKKCEDA
    • Amino acids
      1 to 90
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160782 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CRES
    • CST 8
    • Cst8
    • CST8_HUMAN
    • Cystatin 8
    • cystatin 8 (cystatin related epididymal specific)
    • Cystatin related epididymal specific
    • Cystatin related epididymal specific protein
    • Cystatin related epididymal spermatogenic protein
    • Cystatin related protein epididymis specific
    • Cystatin-8
    • Cystatin-related epididymal spermatogenic protein
    see all
  • Function
    Performs a specialized role during sperm development and maturation.
  • Tissue specificity
    Proximal caput region of the epididymis. Lower expression in the testis. Within the testis it is localized to the elongating spermatids, whereas within the epididymis it is exclusively synthesized by the proximal caput epithelium.
  • Sequence similarities
    Belongs to the cystatin family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab160782 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160782 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160782.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up