Recombinant Human CST9 protein (denatured) (ab113129)

Overview

  • Product nameRecombinant Human CST9 protein (denatured)
  • Protein lengthFull length protein
  • Description
    Recombinant Human CST9 protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ5W186
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMWCSEEEMGGNNKIVQDPMFLATVEFALNT FNVQSKEEHAYRLLRVLS SWREDSMDRKWRGKMVFSMNLQLRQTVCRK FEDDIDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAAD KAI PRDKGK
    • Molecular weight17 kDa including tags
    • Amino acids29 to 159
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113129 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 2.4% Urea, 10% Glycerol

General Info

  • Alternative names
    • CLM
    • Cresp
    • Cst9
    • CST9_HUMAN
    • Cystatin 9 (testatin)
    • Cystatin like molecule
    • Cystatin-9
    • Cystatin-like molecule
    • M12
    • OTTMUSP00000016735
    • RP23-250M11.7
    • Testatin
    see all
  • FunctionMay play a role in hematopoietic differentiation or inflammation.
  • Tissue specificityExpressed in heart, placenta, lung, liver, skeletal muscle and pancreas. Not expressed in brain. Barely expressed in tumor cell lines except for breast adenocarcinoma MCF-7 cells and U251 cells.
  • Sequence similaritiesBelongs to the cystatin family.
  • Cellular localizationSecreted. May be targeted through the Golgi via the secretory pathway.
  • Information by UniProt

Recombinant Human CST9 protein (denatured) images

  • 15% SDS-PAGE analysis of 3 µg ab113129.

References for Recombinant Human CST9 protein (denatured) (ab113129)

ab113129 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113129.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"