Overview

  • Product name
    Recombinant Human CSTF3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSGDGATEQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKA RKTYERLVAQFPSSGRFWKLYIEAEVTILFYFFLYQYCSIHCSDRKQVRN IAN
    • Amino acids
      1 to 103
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158224 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CF 1 77 kDa subunit
    • Cleavage stimulation factor 3' pre RNA subunit 3
    • Cleavage stimulation factor 77 kDa subunit
    • Cleavage stimulation factor subunit 3
    • Cleavage stimulation factor subunit 3 isoform 1
    • CSTF 3
    • CSTF 77
    • CSTF 77 kDa subunit
    • CSTF77
    • MGC117398
    • MGC43001
    • MGC75122
    see all
  • Relevance
    CSTF3 (cleavage stimulation factor subunit 3) is required for polyadenylation and 3'-end cleavage of mammalian pre-mRNAs and is part of the CSTF complex. The CSTF complex is composed of CSTF1 (50 kDa subunit), CSTF2 (64 kDa subunit) and CSTF3 (77 kDa subunit). CSTF3 functions as a homodimer and interacts directly with CSTF1 and CSTF2.
  • Cellular localization
    Nuclear

Images

  • ab158224 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158224 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158224.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up