Recombinant Human CTAGE1 protein (ab163856)

Overview

  • Product name
    Recombinant Human CTAGE1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRPDSHPYGFPWELVIRAAVAGFFAVLFLWRSFRSVTSRLYVRREKKFAV ALSGLIEEKCKLLEKFSLVQKEYEGYEVESSLKNASFEKEATEAQSLEAT CEKLNRFNSELVHEILCLEKELKEEKSKHSEQNELMADISKRIQSLEDES KSLKSQVAEAKMTFKRFQANEERLEIEIQDAWKENSELQESQKQLLQEAE VWKEQVSELIKQKRTFEDSKVHAEQVLNDKENHIKTLTERLLKMKDGVAM LEEDVTDDDNLELEMNSESEDGAYLDNPPKGALKKLIHAAKLNASLKTLE GERNQIYIQLSEVDKTKEELTEHIKNLQTEQASLQSENTHFESENQKLQQ KLKVMTELYQENEMKLYRKLIVEEKCRLEKEEKLSKVDEMISHATEELET YRKRAKDLKEFEKTIHFYQKKIILHEKKAHDNWSAAWTAERNLNDLRKEN AHNRQKLTEIEFKIKLLEKDPYGLDVPNTAFGRQHSPYGPSPLGWPSSET RASLYPPTLLEGPLRLSPLLPRGGGRGSRGPGNPPDHQITKERGESSCDR LTDPHRAPSDAGPLAPPWEQDYRMMFPPPGQSYPDSALPPQRQDRFYSNC ARLSGPAELRSFNMPSLDKMDGSMPSEMESSRNDTKDNLGNLKVPDSSLP AENEATGPGFVPPPLAPIRGLLFPVDTRGPFIRRGPPFPPPPPGTVFGAS PDYFSPRDVPGPPRAPFAMRNVYLPRGFLPYRPPRPAFFPPAPTF
    • Amino acids
      1 to 745
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163856 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cancer/testis antigen 21.2
    • Cancer/testis antigen family 21 member 1
    • Cancer/testis antigen family 21 member 2
    • CT21.2
    • CTAGE
    • CTAGE 1
    • CTAGE 2
    • CTAGE1
    • CTGE2_HUMAN
    • Cutaneous T cell lymphoma associated antigen 1
    • Cutaneous T cell lymphoma associated antigen 2
    • Protein cTAGE-2
    see all
  • Tissue specificity
    Testis. Not found in tumor.
  • Sequence similarities
    Belongs to the cTAGE family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab163856 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163856 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163856.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up