Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP56545
    • SpeciesHuman
    • SequenceMALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLDGRDCTVEMPI LKDLATVAFCDAQSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALRV IVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRRNT WLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAK AFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNH HLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHES EPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIP ESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLP AAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNREHPNEQ
    • Molecular weight75 kDa including tags
    • Amino acids1 to 445

Specifications

Our Abpromise guarantee covers the use of ab114954 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C terminal binding protein 2
    • C-terminal-binding protein 2
    • CtBP2
    • CTBP2_HUMAN
    • ribeye
    see all
  • FunctionCorepressor targeting diverse transcription regulators. Functions in brown adipose tissue (BAT) differentiation.
    Isoform 2 probably acts as a scaffold for specialized synapses.
  • Tissue specificityUbiquitous. Highest levels in heart, skeletal muscle, and pancreas.
  • Sequence similaritiesBelongs to the D-isomer specific 2-hydroxyacid dehydrogenase family.
  • Post-translational
    modifications
    Isoform 2 is phosphorylated upon DNA damage, probably by ATM or ATR at Thr-179; Ser-181 and Ser-185. Phosphorylation by HIPK2 on Ser-428 induces proteasomal degradation.
  • Cellular localizationNucleus. Cell junction > synapse.
  • Information by UniProt

Recombinant Human CTBP2 protein images

  • 12.5% SDS-PAGE showing ab114954 at approximately 75.06kDa.
    Stained with Coomassie Blue.

References for Recombinant Human CTBP2 protein (ab114954)

ab114954 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114954.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"