Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLDGRDCTVEMPI LKDLATVAFCDAQSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALRV IVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRRNT WLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAK AFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNH HLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHES EPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIP ESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLP AAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNREHPNEQ
    • Molecular weight
      75 kDa including tags
    • Amino acids
      1 to 445

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114954 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C terminal binding protein 2
    • C-terminal-binding protein 2
    • CtBP2
    • CTBP2_HUMAN
    • ribeye
    see all
  • Function
    Corepressor targeting diverse transcription regulators. Functions in brown adipose tissue (BAT) differentiation.
    Isoform 2 probably acts as a scaffold for specialized synapses.
  • Tissue specificity
    Ubiquitous. Highest levels in heart, skeletal muscle, and pancreas.
  • Sequence similarities
    Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family.
  • Post-translational
    modifications
    Isoform 2 is phosphorylated upon DNA damage, probably by ATM or ATR at Thr-179; Ser-181 and Ser-185. Phosphorylation by HIPK2 on Ser-428 induces proteasomal degradation.
  • Cellular localization
    Nucleus. Cell junction > synapse.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114954 at approximately 75.06kDa.
    Stained with Coomassie Blue.

References

ab114954 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114954.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up