Recombinant Human CTDSP1 protein (ab124856)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9GZU7
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMDSSAVITQISKEEARGPLRGKGDQKSAAS QKPRSRGILHSLFCCVCRDDGEALPAHSGAPLLVEENGAIPKTPVQYLLP EAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLK RPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESC VFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSD TELHDLLPFFEQLSRVDDVYSVLRQPRPGS
    • Molecular weight31 kDa including tags
    • Amino acids1 to 260
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124856 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab124856 is purified by proprietary chromatographic techniques and sterile filtered.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • Carboxy terminal domain RNA polymerase II polypeptide A small phosphatase 1
    • Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1
    • CTD (carboxy terminal domain RNA polymerase II polypeptide A) small phosphatase 1
    • CTDS1_HUMAN
    • CTDSP1
    • NIF3
    • NLI IF
    • NLI interacting factor 3
    • NLI-IF
    • NLI-interacting factor 3
    • NLIIF
    • Nuclear LIM interactor interacting factor 3
    • Nuclear LIM interactor-interacting factor 3
    • SCP1
    • Small C-terminal domain phosphatase 1
    • Small CTD phosphatase 1
    see all
  • FunctionPreferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residues repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A. Negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation. Recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells.
  • Tissue specificityExpression is restricted to non-neuronal tissues. Highest expression in skeletal muscle, spleen, lung and placenta.
  • Sequence similaritiesContains 1 FCP1 homology domain.
  • Cellular localizationNucleus. Colocalizes with RNA polymerase II.
  • Information by UniProt

References for Recombinant Human CTDSP1 protein (ab124856)

ab124856 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab124856.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"