Recombinant Human CTDSP2 protein (ab160820)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHV GQSSSSTELAAYKEEANTIAKSDLLQCLQYQFYQIPGTCLLPEVTEEDQ
    • Amino acids
      1 to 99
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160820 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Carboxy terminal domain RNA polymerase II polypeptide A small phosphatase 2
    • Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2
    • conserved gene amplified in osteosarcoma
    • conserved gene amplified in osteosarcoma 4
    • CTDS2_HUMAN
    • Ctdsp2
    • NIF2
    • NLI interacting factor 2
    • NLI-interacting factor 2
    • Nuclear LIM interactor interacting factor 2
    • Nuclear LIM interactor-interacting factor 2
    • OS4
    • Protein OS 4
    • Protein OS-4
    • PSR2
    • SCP2
    • Small C-terminal domain phosphatase 2
    • Small CTD phosphatase 2
    see all
  • Function
    Preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residues repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A. Negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation. Recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells. May contribute to the development of sarcomas.
  • Tissue specificity
    Expression is restricted to non-neuronal tissues. Highest expression in pancreas and lowest in liver.
  • Sequence similarities
    Contains 1 FCP1 homology domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160820 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160820 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160820.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up