Recombinant Human CTGF protein (ab69786)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP29279
    • SpeciesHuman
    • SequenceYRLEDTFGP DPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVR PCEADLEENI
    • Molecular weight15 kDa including tags
    • Amino acids182 to 250

Specifications

Our Abpromise guarantee covers the use of ab69786 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

  • Purity>90% by SDS-PAGE.
    Sterile Filtered
  • FormLyophilised
  • Additional notesFor long-term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    No additives

  • ReconstitutionReconstitute in sterile 18MOhm/cm water to not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

General Info

  • Alternative names
    • CCN 2
    • CCN family member 2
    • CCN2
    • Connective tissue growth factor
    • Ctgf
    • CTGF_HUMAN
    • Hcs 24
    • Hcs24
    • Hypertrophic chondrocyte specific protein 24
    • Hypertrophic chondrocyte-specific gene product 24
    • Hypertrophic chondrocyte-specific protein 24
    • IBP-8
    • IGF-binding protein 8
    • IGFBP-8
    • IGFBP8
    • Insulin like Growth Factor Binding Protein 8
    • Insulin-like growth factor-binding protein 8
    • MGC102839
    • NOV 2
    • NOV2
    see all
  • FunctionMajor connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis.
  • Tissue specificityExpressed in bone marrow and thymic cells. Also expressed one of two Wilms tumors tested.
  • Sequence similaritiesBelongs to the CCN family.
    Contains 1 CTCK (C-terminal cystine knot-like) domain.
    Contains 1 IGFBP N-terminal domain.
    Contains 1 TSP type-1 domain.
    Contains 1 VWFC domain.
  • Cellular localizationSecreted > extracellular space > extracellular matrix. Secreted.
  • Information by UniProt

References for Recombinant Human CTGF protein (ab69786)

ab69786 has not yet been referenced specifically in any publications.

Product Wall

The protein ab69786 has not, to our knowledge, been tested for activity. The other two have been tested in the activity assays described briefly on the datasheets, but we do not know if they will be suitable for your study. They differ in that they are...

Read More

Thank you for contacting us. The concentration should be at least 100 ug/ml, so add no more than 100 ul of water to 10 ug of CTGF to reconstitute. The datasheet states: Reconstitute in sterile 18MOhm/cm water to not less than 100 µg/ml, which can th...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"