Recombinant Human CTHRC1 protein (ab112430)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIP GRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKM RSNSALRVLF
    • Molecular weight
      38 kDa including tags
    • Amino acids
      32 to 141

Specifications

Our Abpromise guarantee covers the use of ab112430 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Collagen triple helix repeat containing 1
    • Collagen triple helix repeat containing protein 1
    • Collagen triple helix repeat-containing protein 1
    • CTHR1_HUMAN
    • Cthrc1
    • NMTC1 protein
    • Protein NMTC1
    see all
  • Function
    May act as a negative regulator of collagen matrix deposition.
  • Tissue specificity
    Isoform 1 is expressed in calcified atherosclerotic plaque and chondrocyte-like cells.
  • Sequence similarities
    Contains 1 collagen-like domain.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • ab112430 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab112430 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112430.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up