Recombinant Human CTHRC1 protein (ab112430)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ96CG8
    • SpeciesHuman
    • SequenceEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIP GRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKM RSNSALRVLF
    • Molecular weight38 kDa including tags
    • Amino acids32 to 141

Specifications

Our Abpromise guarantee covers the use of ab112430 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Collagen triple helix repeat containing 1
    • Collagen triple helix repeat containing protein 1
    • Collagen triple helix repeat-containing protein 1
    • CTHR1_HUMAN
    • Cthrc1
    • NMTC1 protein
    • Protein NMTC1
    see all
  • FunctionMay act as a negative regulator of collagen matrix deposition.
  • Tissue specificityIsoform 1 is expressed in calcified atherosclerotic plaque and chondrocyte-like cells.
  • Sequence similaritiesContains 1 collagen-like domain.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localizationSecreted > extracellular space > extracellular matrix.
  • Information by UniProt

Recombinant Human CTHRC1 protein images

  • ab112430 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human CTHRC1 protein (ab112430)

ab112430 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112430.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"