Recombinant Human CTHRC1 protein (ab191933)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGI PGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTK MRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQ GSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGW NSVSRIIIEELPKVDHHHHHH
    • Molecular weight
      24 kDa including tags
    • Amino acids
      31 to 243
    • Tags
      His tag C-Terminus
    • Additional sequence information
      This product is for the mature full length protein from aa 31 to 243. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab191933 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Reconstitute for long term storage.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride

General Info

  • Alternative names
    • Collagen triple helix repeat containing 1
    • Collagen triple helix repeat containing protein 1
    • Collagen triple helix repeat-containing protein 1
    • CTHR1_HUMAN
    • Cthrc1
    • NMTC1 protein
    • Protein NMTC1
    see all
  • Function
    May act as a negative regulator of collagen matrix deposition.
  • Tissue specificity
    Isoform 1 is expressed in calcified atherosclerotic plaque and chondrocyte-like cells.
  • Sequence similarities
    Contains 1 collagen-like domain.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

References

ab191933 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191933.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up