Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MNISGSSCGSPNSADTSSDFKDLWTKLKECHDREVQGLQVKVTKLKQERI LDAQRLEEFFTKNQQLREQQKVLHETIKVLEDRLRAGLCDRCAVTEEHMR KKQQEFENIRQQNLKLITELMNERNTLQEENKKLSEQLQQKIENDQQHQA AELECEEDVIPDSPITAFSFSGVNRLRRKENPHVRYIEQTHTKLEHSVCA NEMRKVSKSSTHPQHNPNENEILVADTYDQSQSPMAKAHGTSSYTPDKSS FNLATVVAETLGLGVQEESETQGPMSPLGDELYHCLEGNHKKQPFEESTR NTEDSLRFSDSTSKTPPQEELPTRVSSPVFGATSSIKSGLDLNTSLSPSL LQPGKKKHLKTLPFSNTCISRLEKTRSKSEDSALFTHHSLGSEVNKIIIQ SSNKQILINKNISESLGEQNRTEYGKDSNTDKHLEPLKSLGGRTSKRKKT EEESEHEVSCPQASFDKENAFPFPMDNQFSMNGDCVMDKPLDLSDRFSAI QRQEKSQGSETSKNKFRQVTLYEALKTIPKGFSSSRKASDGNCTLPKDSP GEPCSQECIILQPLNKCSPDNKPSLQIKEENAVFKIPLRPRESLETENVL DDIKSAGSHEPIKIQTRSDHGGCELASVLQLNPCRTGKIKSLQNNQDVSF ENIQWSIDPGADLSQYKMDVTVIDTKDGSQSKLGGETVDMDCTLVSETVL LKMKKQEQKGEKSSNEERKMNDSLEDMFDRTTHEEYESCLADSFSQAADE EEELSTATKKLHTHGDKQDKVKQKAFVEPYFKGDERETSLQNFPHIEVVR KKEERRKLLGHTCKECEIYYADMPAEEREKKLASCSRHRFRYIPPNTPEN FWEVGFPSTQTCMERGYIKEDLDPCPRPKRRQPYNAIFSPKGKEQKT
    • Molecular weight
      128 kDa including tags
    • Amino acids
      1 to 897
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152651 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • COM1
    • COM1_HUMAN
    • CtBP interacting protein
    • CtBP-interacting protein
    • CtIP
    • DNA endonuclease RBBP8
    • JWDS
    • RB binding protein 8 endonuclease
    • RBBP-8
    • RBBP8
    • Retinoblastoma-binding protein 8
    • Retinoblastoma-interacting protein and myosin-like
    • Rim
    • SAE2
    • SCKL2
    • Sporulation in the absence of SPO11 protein 2 homolog
    see all
  • Function
    Endonuclease that cooperates with the MRE11-RAD50-NBN (MRN) complex in processing meiotic and mitotic double-strand breaks (DSBs) by ensuring both resection and intrachromosomal association of the broken ends. Functions downstream of the MRN complex and ATM, promotes ATR activation and its recruitment to DSBs in the S/G2 phase facilitating the generation of ssDNA. Component of the BRCA1-RBBP8 complex that regulates CHEK1 activation and controls cell cycle G2/M checkpoints on DNA damage. Promotes microhomology-mediated alternative end joining (A-NHEJ) during class-switch recombination and plays an essential role in chromosomal translocations.
  • Involvement in disease
    Seckel syndrome 2
    Jawad syndrome
    Genetic variability in RBBP8 is noted as a factor in BRCA1-associated breast cancer risk (PubMed:21799032). Exhibits sensitivity to tamoxifen in certain breast cancer cell lines (PubMed:18171986).
  • Sequence similarities
    Belongs to the COM1/SAE2/CtIP family.
  • Domain
    The PXDLS motif binds to a cleft in CtBP proteins.
    The damage-recruitment motif is required for DNA binding and translocation to sites of DNA damage.
  • Post-translational
    modifications
    Acetylated. Deacetylation by SIRT6 upon DNA damage promotes DNA end resection.
    Hyperphosphorylation upon ionizing radiation results in dissociation from BRCA1. Phosphorylation at Thr-847 by CDK1 is essential for the recruitment to DNA and the DNA repair function. Phosphorylated on Ser-327 as cells enter G2 phase. This phosphorylation is required for binding BRCA1 and for the G2/M DNA damage transition checkpoint control.
    Ubiquitinated (PubMed:14654780, PubMed:16818604). Ubiquitination at multiple sites by BRCA1 (via its N-terminal RING domain) does not lead to its proteosomal degradation but instead the ubiquitinated RBBP8 binds to chromatin following DNA damage and may play a role in G2/M checkpoint control (PubMed:16818604). Ubiquitinated by RNF138 at its N-terminus (PubMed:26502057).
  • Cellular localization
    Nucleus. Chromosome. Associates with sites of DNA damage in S/G2 phase (PubMed:10764811). Ubiquitinated RBBP8 binds to chromatin following DNA damage (PubMed:16818604).
  • Information by UniProt

Images

  • ab152651 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152651 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152651.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up