Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQ CQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPS
    • Molecular weight
      35 kDa including tags
    • Amino acids
      1 to 88

Specifications

Our Abpromise guarantee covers the use of ab112415 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    ab112415 is best use within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • 2810047E18Rik
    • B cell CLL/lymphoma 11A (zinc finger protein)
    • B cell CLL/lymphoma 11A (zinc finger protein) isoform 2
    • B-cell CLL/lymphoma 11A
    • B-cell lymphoma/leukemia 11A
    • BC11A_HUMAN
    • BCL-11A
    • BCL11A
    • BCL11A B cell CLL/lymphoma 11A (zinc finger protein) isoform 1
    • BCL11A L
    • BCL11A S
    • BCL11A XL
    • BCL11a-M
    • BCL11AL
    • BCL11AS
    • BCL11AXL
    • C2H2 type zinc finger protein
    • COUP TF interacting protein 1
    • COUP-TF-interacting protein 1
    • CTIP1
    • CTIP1, mouse, homolog of
    • D930021L15Rik
    • Ecotropic viral integration site 9
    • Ecotropic viral integration site 9 homolog
    • Ecotropic viral integration site 9 protein
    • Ecotropic viral integration site 9 protein homolog
    • EVI-9
    • Evi9
    • Evi9, mouse, homolog of
    • FLJ10173
    • FLJ34997
    • HBFQTL5
    • KIAA1809
    • mKIAA1809
    • OTTHUMP00000159788
    • OTTHUMP00000159789
    • OTTHUMP00000201250
    • OTTHUMP00000202084
    • Zinc finger protein 856
    • ZNF856
    see all
  • Function
    Functions as a myeloid and B-cell proto-oncogene. May play important roles in leukemogenesis and hematopoiesis. An essential factor in lymphopoiesis, is required for B-cell formation in fetal liver. May function as a modulator of the transcriptional repression activity of ARP1.
  • Tissue specificity
    Expressed at high levels in brain, spleen thymus, bone marrow and testis. Expressed in CD34-positive myeloid precursor cells, B-cells, monocytes and megakaryocytes. Expression is tightly regulated during B-cell development.
  • Involvement in disease
    Note=Chromosomal aberrations involving BCL11A may be a cause of lymphoid malignancies. Translocation t(2;14)(p13;q32.3) causes BCL11A deregulation and amplification.
  • Sequence similarities
    Contains 6 C2H2-type zinc fingers.
  • Post-translational
    modifications
    Sumoylated by SUMO1.
  • Cellular localization
    Cytoplasm. Nucleus. Associates with the nuclear body. Colocalizes with SUMO1 and SENP2 in nuclear speckles.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab112415 stained with Coomassie Blue.

References

ab112415 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112415.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up