Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9H165
    • SpeciesHuman
    • SequenceMSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQ CQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPS
    • Molecular weight35 kDa including tags
    • Amino acids1 to 88

Specifications

Our Abpromise guarantee covers the use of ab112415 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesab112415 is best use within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • 2810047E18Rik
    • B cell CLL/lymphoma 11A (zinc finger protein)
    • B cell CLL/lymphoma 11A (zinc finger protein) isoform 2
    • B-cell CLL/lymphoma 11A
    • B-cell lymphoma/leukemia 11A
    • BC11A_HUMAN
    • BCL-11A
    • BCL11A
    • BCL11A B cell CLL/lymphoma 11A (zinc finger protein) isoform 1
    • BCL11A L
    • BCL11A S
    • BCL11A XL
    • BCL11a-M
    • BCL11AL
    • BCL11AS
    • BCL11AXL
    • C2H2 type zinc finger protein
    • COUP TF interacting protein 1
    • COUP-TF-interacting protein 1
    • CTIP1
    • CTIP1, mouse, homolog of
    • D930021L15Rik
    • Ecotropic viral integration site 9
    • Ecotropic viral integration site 9 homolog
    • Ecotropic viral integration site 9 protein
    • Ecotropic viral integration site 9 protein homolog
    • EVI-9
    • Evi9
    • Evi9, mouse, homolog of
    • FLJ10173
    • FLJ34997
    • HBFQTL5
    • KIAA1809
    • mKIAA1809
    • OTTHUMP00000159788
    • OTTHUMP00000159789
    • OTTHUMP00000201250
    • OTTHUMP00000202084
    • Zinc finger protein 856
    • ZNF856
    see all
  • FunctionFunctions as a myeloid and B-cell proto-oncogene. May play important roles in leukemogenesis and hematopoiesis. An essential factor in lymphopoiesis, is required for B-cell formation in fetal liver. May function as a modulator of the transcriptional repression activity of ARP1.
  • Tissue specificityExpressed at high levels in brain, spleen thymus, bone marrow and testis. Expressed in CD34-positive myeloid precursor cells, B-cells, monocytes and megakaryocytes. Expression is tightly regulated during B-cell development.
  • Involvement in diseaseNote=Chromosomal aberrations involving BCL11A may be a cause of lymphoid malignancies. Translocation t(2;14)(p13;q32.3) causes BCL11A deregulation and amplification.
  • Sequence similaritiesContains 6 C2H2-type zinc fingers.
  • Post-translational
    modifications
    Sumoylated by SUMO1.
  • Cellular localizationCytoplasm. Nucleus. Associates with the nuclear body. Colocalizes with SUMO1 and SENP2 in nuclear speckles.
  • Information by UniProt

Recombinant Human Ctip1 protein images

  • 12.5% SDS-PAGE showing ab112415 stained with Coomassie Blue.

References for Recombinant Human Ctip1 protein (ab112415)

ab112415 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112415.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"