Recombinant Human CTNNAL1 protein (ab160164)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAASPGPAGVGGAGAVYGSGSSGFALDSGLEIKTRSVEQTLLPLVSQITT LINHKDNTKKSDKTLQAIQRVGQAVNLAVGRFVKVGEAIANENWDLKEEI NIACIEAKQAGETIAALTDITNLNHLESDGQITIFTDKTGVIKAARLLLS SVTKVLLLADRVVIKQIITSRNKVLATMERLEKVNSFQEFVQIFSQFGNE MVEFAHLSGDRQNDLKDEKKKAKMAAARAVLEKCTMMLLTASKTCLRHPN CESAHKNKEGVFDRMKVALDKVIEIVTDCKPNGETDISSISIFTGIKEFK MNIEALRENLYFQSKENLSVTLEVILERMEDFTDSAYTSHEHRERILELS TQARMELQQLISVWIQAQSKKTKSIAEELELSILKISHSLNELKKELHST ATQLAADLLKYHADHVVLKALKLTGVEGNLEALAEYACKLSEQKEQLVET CRLLRHISGTEPLEITCIHAEETFQVTGQQIISAAETLTLHPSSKIAKEN LDVFCEAWESQISDMSTLLREINDVFEGRRGEKYGYLSLPKPMKNNANLK SLKPDKPDSEEQAKIAKLGLKLGLLTSDADCEIEKWEDQENEIVQYGRNM SSMAYSLYLFTRGEGPLKTSQDLIHQLEVFAAEGLKLTSSVQAFSKQLKD DDKLMLLLEINKLIPLCHQLQTVTKTSLQNKVFLKVDKCITKTRSMMALL VQLLSLCYKLLKKLQMENNGWVSVTNKDTMDSKT
    • Amino acids
      1 to 734
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160164 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACRP
    • Alpha catenin related protein
    • alpha CATU
    • Alpha catulin
    • Alpha-catenin-related protein
    • Alpha-catulin
    • alpha2 catulin
    • catenin (cadherin associated protein), alpha like 1
    • Catenin alpha like protein 1
    • Catenin alpha-like protein 1
    • catenin, alpha like 1
    • CLLP
    • CTNL1_HUMAN
    • CTNNAL1
    • Highly similar to ALPHA CATENIN
    see all
  • Function
    May modulate the Rho pathway signaling by providing a scaffold for the Lbc Rho guanine nucleotide exchange factor (ARHGEF1).
  • Tissue specificity
    Widely expressed. Expressed at lower level in neural tissues and at the highest level in the adrenal gland.
  • Sequence similarities
    Belongs to the vinculin/alpha-catenin family.
  • Cellular localization
    Cytoplasm > cytoskeleton. Cell membrane.
  • Information by UniProt

Images

  • ab160164 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160164 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160164.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up