Recombinant Human CTNNBIP1 protein (ab101468)

Overview

  • Product nameRecombinant Human CTNNBIP1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9NSA3
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMNREGAPGKSPEEMYIQQKVRVLLMLRKMG SNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRR Q
    • Molecular weight11 kDa including tags
    • Amino acids1 to 81
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101468 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab101468 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0

General Info

  • Alternative names
    • Beta catenin interacting protein 1
    • Beta catenin interacting protein ICAT
    • Beta-catenin-interacting protein 1
    • Catenin beta interacting protein 1
    • CNBP1_HUMAN
    • CTNNBIP 1
    • CTNNBIP1
    • ICAT
    • Inhibitor of beta catenin and Tcf 4
    • Inhibitor of beta-catenin and Tcf-4
    • MGC15093
    see all
  • FunctionPrevents the interaction between CTNNB1 and TCF family members, and acts as negative regulator of the Wnt signaling pathway.
  • Sequence similaritiesBelongs to the CTNNBIP1 family.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt

Recombinant Human CTNNBIP1 protein images

  • 15% SDS-PAGE analysis of 3µg ab101468.

References for Recombinant Human CTNNBIP1 protein (ab101468)

ab101468 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101468.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"