Recombinant Human CTNNBIP1 protein (ab101468)

Overview

  • Product name
    Recombinant Human CTNNBIP1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMNREGAPGKSPEEMYIQQKVRVLLMLRKMG SNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRR Q
    • Molecular weight
      11 kDa including tags
    • Amino acids
      1 to 81
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101468 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab101468 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0

General Info

  • Alternative names
    • Beta catenin interacting protein 1
    • Beta catenin interacting protein ICAT
    • Beta-catenin-interacting protein 1
    • Catenin beta interacting protein 1
    • CNBP1_HUMAN
    • CTNNBIP 1
    • CTNNBIP1
    • ICAT
    • Inhibitor of beta catenin and Tcf 4
    • Inhibitor of beta-catenin and Tcf-4
    • MGC15093
    see all
  • Function
    Prevents the interaction between CTNNB1 and TCF family members, and acts as negative regulator of the Wnt signaling pathway.
  • Sequence similarities
    Belongs to the CTNNBIP1 family.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab101468.

References

ab101468 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101468.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up