Recombinant Human CTNNBL1 protein (ab153418)

Overview

  • Product name
    Recombinant Human CTNNBL1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EKHDMVRRGEIIDNDTEEEFYLRRLDAGLFVLQHICYIMAEICNANVPQI RQRVHQILNMRGSSIKIVRHIIKEYAENIGDGRSPEFRENEQKRILGLLE NF
    • Amino acids
      210 to 311
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153418 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5730471K09Rik
    • Beta catenin like 1
    • Beta catenin like protein 1
    • Beta-catenin-like protein 1
    • C20orf33
    • Cadherin associated protein
    • Catenin beta like 1
    • Chromosome 20 open reading frame 3
    • CTBL1_HUMAN
    • CTNN protein
    • CTNNBL 1
    • Ctnnbl1
    • dJ633O20.1
    • FLJ21108
    • NAP
    • Nuclear associated protein
    • nuclear protein NAP
    • Nuclear-associated protein
    • NYD SP19
    • OTTMUSP00000016933
    • P14
    • P14L
    • PP8304
    • RP5 1118M15.1
    • Testis development protein NYD SP19
    • Testis development protein NYD-SP19
    see all
  • Function
    Induces apoptosis in CHO cells.
  • Tissue specificity
    Widely expressed with highest levels in skeletal muscle, placenta, heart, spleen, testis and thyroid.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab153418 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153418 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153418.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up