Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPA GTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMIC
    • Molecular weight
      37 kDa including tags
    • Amino acids
      101 to 200

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116938 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Chymotrypsinogen B
    • Chymotrypsinogen B1
    • ChymotrypsinogenB
    • ChymotrypsinogenB1
    • CTRB
    • CTRB 1
    • FLJ42412
    • MGC88037
    • OTTHUMP00000214638
    see all
  • Relevance
    CTRB1 (Chymotrypsinogen B1) is the inactive precursor of Alpha chymotrypsin, one of a family of serine proteases secreted into the gastrointestinal tract. The zymogen is activated by proteolytic cleavage by trypsin.
  • Cellular localization
    Secreted, extracellular space.

Recombinant Human CTRB1 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116938 at approximately 36.63 kDa.

References for Recombinant Human CTRB1 protein (ab116938)

ab116938 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116938.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up