Recombinant Human CUG-BP1 protein (ab153111)

Overview

  • Product name
    Recombinant Human CUG-BP1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRD RSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSE KNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGC AFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQ LQQQMQQISAASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMG GLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSVLTSSAGSSPSS SSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTG STMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANL FIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPV SAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY
    • Amino acids
      1 to 483
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153111 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 50 kDa Nuclear polyadenylated RNA binding protein
    • 50 kDa nuclear polyadenylated RNA-binding protein
    • Bruno like 2
    • bruno like protein 2
    • Bruno-like protein 2
    • BRUNOL 2
    • BRUNOL2
    • CELF 1
    • CELF-1
    • celf1
    • CELF1 CUGBP, Elav like family member 1
    • CELF1_HUMAN
    • CUG BP
    • CUG BP and ETR 3 like factor 1
    • CUG BP1
    • CUG RNA binding protein
    • CUG triplet repeat RNA binding protein 1
    • CUG triplet repeat RNA-binding protein 1
    • CUG-BP
    • CUG-BP- and ETR-3-like factor 1
    • CUG-BP1
    • CUGBP
    • CUGBP 1
    • CUGBP and ETR3 like factor 1
    • CUGBP Elav like family member 1
    • CUGBP Elav-like family member 1
    • CUGBP1
    • Cytidine uridine guanosine binding protein 1
    • Deadenylation factor CUG BP
    • Deadenylation factor CUG-BP
    • Deadenylation factor CUGBP
    • EDEN BP
    • EDEN BP homolog
    • EDEN-BP
    • EDEN-BP homolog
    • embryo deadenylation element binding protein
    • embryo deadenylation element binding protein homolog
    • Embryo deadenylation element-binding protein homolog
    • hNab 50
    • hNab50
    • NAB 50
    • NAB50
    • NAPOR
    • Nuclear polyadenylated RNA binding protein
    • Nuclear polyadenylated RNA binding protein 50 kD
    • RNA binding protein BRUNOL 2
    • RNA binding protein BRUNOL2
    • RNA-binding protein BRUNOL-2
    see all
  • Function
    RNA-binding protein implicated in the regulation of several post-transcriptional events. Involved in pre-mRNA alternative splicing, mRNA translation and stability. Mediates exon inclusion and/or exclusion in pre-mRNA that are subject to tissue-specific and developmentally regulated alternative splicing. Specifically activates exon 5 inclusion of cardiac isoforms of TNNT2 during heart remodeling at the juvenile to adult transition. Acts as both an activator and repressor of a pair of coregulated exons: promotes inclusion of the smooth muscle (SM) exon but exclusion of the non-muscle (NM) exon in actinin pre-mRNAs. Activates SM exon 5 inclusion by antagonizing the repressive effect of PTB. Promotes exclusion of exon 11 of the INSR pre-mRNA. Inhibits, together with HNRNPH1, insulin receptor (IR) pre-mRNA exon 11 inclusion in myoblast. Increases translation and controls the choice of translation initiation codon of CEBPB mRNA. Increases mRNA translation of CEBPB in aging liver (By similarity). Increases translation of CDKN1A mRNA by antagonizing the repressive effect of CALR3. Mediates rapid cytoplasmic mRNA deadenylation. Recruits the deadenylase PARN to the poly(A) tail of EDEN-containing mRNAs to promote their deadenylation. Required for completion of spermatogenesis (By similarity). Binds to (CUG)n triplet repeats in the 3'-UTR of transcripts such as DMPK and to Bruno response elements (BREs). Binds to muscle-specific splicing enhancer (MSE) intronic sites flanking the alternative exon 5 of TNNT2 pre-mRNA. Binds to AU-rich sequences (AREs or EDEN-like) localized in the 3'-UTR of JUN and FOS mRNAs. Binds to the IR RNA. Binds to the 5'-region of CDKN1A and CEBPB mRNAs. Binds with the 5'-region of CEBPB mRNA in aging liver.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the CELF/BRUNOL family.
    Contains 3 RRM (RNA recognition motif) domains.
  • Post-translational
    modifications
    Phosphorylated. Its phosphorylation status increases in senescent cells.
  • Cellular localization
    Nucleus. Cytoplasm. RNA-binding activity is detected in both nuclear and cytoplasmic compartments.
  • Information by UniProt

Images

  • ab153111 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153111 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153111.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up