Recombinant Human Cullin 5 protein (ab159938)

Overview

  • Product name
    Recombinant Human Cullin 5 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MATSNLLKNKGSLQFEDKWDFMRPIVLKLLRQESVTKQQWFDLFSDVHAV CLWDDKGPAKIHQALKEDILEFIKQAQARVLSHQDDTALLKAYIVEWRKF
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159938 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CUL 5
    • CUL-5
    • CUL5
    • CUL5_HUMAN
    • Cullin-5
    • Cullin-5 (vasopressin-activated calcium-mobilizing receptor-1)
    • Cullin5
    • VACM 1
    • VACM-1
    • VACM1
    • Vasopressin activated calcium mobilizing receptor
    • Vasopressin activated calcium mobilizing receptor 1
    • Vasopressin-activated calcium-mobilizing receptor 1
    • Vasopressin-activated calcium-mobilizing receptor-1
    see all
  • Function
    Core component of multiple SCF-like ECS (Elongin-Cullin 2/5-SOCS-box protein) E3 ubiquitin-protein ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. As a scaffold protein may contribute to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. The functional specificity of the E3 ubiquitin-protein ligase complex depends on the variable substrate recognition component. ECS(SOCS1) seems to direct ubiquitination of JAK2. Seems to be involved in proteosomal degradation of p53/TP53 stimulated by adenovirus E1B-55 kDa protein. May form a cell surface vasopressin receptor.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the cullin family.
  • Post-translational
    modifications
    Neddylated; which enhances the ubiquitination activity of SCF and prevents binding of the inhibitor CAND1. Deneddylated via its interaction with the COP9 signalosome (CSN).
  • Information by UniProt

Images

  • ab159938 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159938 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159938.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up