Overview

  • Product name
    Recombinant Human CUTC protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMKRQGASSERKRARIPSGKAGAANGFLMEV CVDSVESAVNAERGGADRIELCSGLSEGGTTPSMGVLQVVKQSVQIPVFV MIRPRGGDFLYSDREIEVMKADIRLAKLYGADGLVFGALTEDGHIDKELC MSLMAICRPLPVTFHRAFDMVHDPMAALETLLTLGFERVLTSGCDSSALE GLPLIKRLIEQAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSARSTRD SGMKFRNSSVAMGASLSCSEYSLKVTDVTKVRTLNAIAKNILV
    • Molecular weight
      32 kDa including tags
    • Amino acids
      1 to 273
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab111633 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab111633 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.08% DTT, 1.17% Sodium chloride

General Info

  • Alternative names
    • CGI 32
    • CGI32
    • Copper homeostasis protein cutC homolog
    • cutC
    • CutC copper transporter homolog (E. coli)
    • CUTC_HUMAN
    • RP11-483F11.3
    see all
  • Function
    May play a role in copper homeostasis. Can bind one Cu(1+) per subunit.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the CutC family.
  • Cellular localization
    Cytoplasm. Nucleus. The overexpressed protein is detected in the cytoplasm, and depending on the cell line, also in the nucleus.
  • Information by UniProt

Recombinant Human CUTC protein images

  • 15% SDS-PAGE showing ab111633 at approximately 31.5kDa (3µg).

References for Recombinant Human CUTC protein (ab111633)

ab111633 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab111633.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up