Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ13948-1
    • SpeciesHuman
    • SequenceAENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELR YSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTI
    • Molecular weight37 kDa including tags
    • Amino acids521 to 620

Specifications

Our Abpromise guarantee covers the use of ab114403 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.03% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CASP
    • CCAAT displacement protein
    • CDP
    • CDP/Cut
    • CDP1
    • Clox
    • COY1
    • Cut homeobox
    • Cut homolog
    • Cut like 1
    • Cut like homeobox 1
    • CUTL1
    • CUX
    • Cux/CDP
    • CUX1
    • Golgi integral membrane protein 6
    • GOLIM6
    • Homeobox protein cux 1
    • Nbla10317
    • p100
    • p110
    • p200
    • p75
    • Protein CASP
    • Putative protein product of Nbla10317
    see all
  • RelevanceBelongs to the CASP family. May be involved in intra-Golgi retrograde transport. Homodimer; disulfide-linked. Interacts with GOLGA5.
  • Cellular localizationGolgi apparatus membrane; Single-pass type IV membrane protein

Recombinant Human CUTL1 protein images

  • 12.5% SDS-PAGE analysis of ab114403 stained with Coomassie Blue.

References for Recombinant Human CUTL1 protein (ab114403)

ab114403 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114403.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"