Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSHRTSSTFRAERSFHSSSSSSSSSTSSSA SRALPAQDPPMEKALSMFSDDFGSFMRPHSEPLAFPARPGGAGNIKTLGD AYEFAVDVRDFSPEDIIVTTSNNHIEVRAEKLAADGTVMNTFAHKCQLPE DVDPTSVTSALREDGSLTIRARRHPHTEHVQQTFRTEIKI
    • Molecular weight
      21 kDa including tags
    • Amino acids
      1 to 170
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab117161 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.
    ab117161 is purified by standard chromatography and filter sterilized.
  • Form
    Liquid
  • Additional notes
    ab117161 should be stored desiccated.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 1.17% Sodium chloride, 0.03% DTT, 50% Glycerol

General Info

  • Alternative names
    • Cardiovascular heat shock protein
    • cvHsp
    • DKFZp779D0968
    • FLJ32733
    • Heat shock 27kda protein family member 7
    • Heat shock protein beta 7
    • Heat shock protein beta-7
    • Hsp25 2
    • HspB7
    • HSPB7_HUMAN
    • Hypothetical protein flj34956
    • RP11-5P18.6
    see all
  • Tissue specificity
    Isoform 1 is highly expressed in adult and fetal heart, skeletal muscle, and at a much lower levels in adipose tissue and in aorta. Undetectable in other tissues. Isoform 2 and isoform 3 are poorly detected in heart.
  • Sequence similarities
    Belongs to the small heat shock protein (HSP20) family.
  • Cellular localization
    Cytoplasm. Nucleus. Nucleus > Cajal body. Resides in sub-nuclear structures known as SC35 speckles or nuclear splicing speckles.
  • Information by UniProt

References for Recombinant Human cvHSP protein (ab117161)

ab117161 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117161.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up