Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSHRTSSTFRAERSFHSSSSSSSSSTSSSA SRALPAQDPPMEKALSMFSDDFGSFMRPHSEPLAFPARPGGAGNIKTLGD AYEFAVDVRDFSPEDIIVTTSNNHIEVRAEKLAADGTVMNTFAHKCQLPE DVDPTSVTSALREDGSLTIRARRHPHTEHVQQTFRTEIKI
    • Molecular weight
      21 kDa including tags
    • Amino acids
      1 to 170
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab117161 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.
    ab117161 is purified by standard chromatography and filter sterilized.
  • Form
    Liquid
  • Additional notes
    ab117161 should be stored desiccated.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 1.17% Sodium chloride, 0.03% DTT, 50% Glycerol

General Info

  • Alternative names
    • Cardiovascular heat shock protein
    • cvHsp
    • DKFZp779D0968
    • FLJ32733
    • Heat shock 27kda protein family member 7
    • Heat shock protein beta 7
    • Heat shock protein beta-7
    • Hsp25 2
    • HspB7
    • HSPB7_HUMAN
    • Hypothetical protein flj34956
    • RP11-5P18.6
    see all
  • Tissue specificity
    Isoform 1 is highly expressed in adult and fetal heart, skeletal muscle, and at a much lower levels in adipose tissue and in aorta. Undetectable in other tissues. Isoform 2 and isoform 3 are poorly detected in heart.
  • Sequence similarities
    Belongs to the small heat shock protein (HSP20) family.
  • Cellular localization
    Cytoplasm. Nucleus. Nucleus > Cajal body. Resides in sub-nuclear structures known as SC35 speckles or nuclear splicing speckles.
  • Information by UniProt

References

ab117161 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117161.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up