Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFC ADPKEQW VKDAMQHLDRQAAALTRNG
    • Molecular weight
      9 kDa
    • Amino acids
      25 to 100
    • Additional sequence information
      Fractalkine Human Recombinant- produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 76 amino acids and having a molecular mass of 8638 Dalton.

Specifications

Our Abpromise guarantee covers the use of ab73766 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    ab73766 is purified by proprietary chromatographic techniques. Purity is greater than 97.0% as determined by RP-HPLC and SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 50mM Sodium chloride, 20mM PBS, pH 7.4

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in sterile 18MO-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

General Info

  • Alternative names
    • A 152E5.2
    • AB030188
    • ABCD 3
    • ABCD3
    • AI848747
    • C-X3-C motif chemokine 1
    • C3Xkine
    • Chemokine (C-X3-C motif) ligand 1
    • Chemokine C X3 C motif ligand 1
    • Chemokine CX3C Motif Ligand 1
    • CX3C membrane anchored chemokine
    • CX3C membrane-anchored chemokine
    • Cx3cl1
    • CXC 3
    • CXC3
    • CXC3C
    • D8Bwg0439e
    • FKN
    • Fractalkine
    • Neurotactin
    • NTN
    • NTT
    • Processed fractalkine
    • SCYD 1
    • SCYD1
    • Small inducible cytokine D1
    • Small inducible cytokine subfamily D (Cys X3 Cys) member 1
    • small inducible cytokine subfamily D (Cys-X3-Cys), member 1 (fractalkine, neurotactin)
    • Small inducible cytokine subfamily D member 1
    • Small-inducible cytokine D1
    • X3CL1_HUMAN
    see all
  • Function
    The soluble form is chemotactic for T-cells and monocytes, but not for neutrophils. The membrane-bound form promotes adhesion of those leukocytes to endothelial cells. May play a role in regulating leukocyte adhesion and migration processes at the endothelium. Binds to CX3CR1.
  • Tissue specificity
    Small intestine, colon, testis, prostate, heart, brain, lung, skeletal muscle, kidney and pancreas.
  • Sequence similarities
    Belongs to the intercrine delta family.
  • Post-translational
    modifications
    A soluble short 95 kDa form may be released by proteolytic cleavage from the long membrane-anchored form.
    O-glycosylated with core 1 or possibly core 8 glycans.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

References

ab73766 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab73766.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up