Overview

  • Product name
    Recombinant Human CXCR1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSNITDPQMWDFDDLNFTGMPPADEDYSPCRLETETLNKYVVIIAYALVF LLSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKV NGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKR HLVKFVCLGCWGLSMNLSLPFFLFRQAYHPNNSSPVCYEVLGNDTAKWRM VLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRAMRVIFAVVLI FLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCL NPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHCVTSYTSSSVNVSSNL
    • Amino acids
      1 to 350
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158759 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C C
    • C C CKR 1
    • C-X-C chemokine receptor type 1
    • CCCKR1
    • CD 181
    • CD128
    • CD181
    • CD181 antigen
    • CDw128a
    • Chemokine (C X C motif) receptor 1
    • Chemokine (C X C) receptor 1
    • Chemokine receptor 1
    • CKR 1
    • CMKAR1
    • CXC-R1
    • CXCR 1
    • CXCR-1
    • CXCR1
    • CXCR1_HUMAN
    • High affinity interleukin 8 receptor A
    • High affinity interleukin-8 receptor A
    • IL 8 receptor type 1
    • IL 8R A
    • IL-8 receptor type 1
    • IL-8R A
    • IL8 receptor
    • IL8 receptor type 1
    • IL8R1
    • IL8RA
    • IL8RBA
    • Interleukin 8 receptor alpha
    • Interleukin 8 receptor type 1
    • Interleukin 8 receptor type A
    see all
  • Function
    Receptor to interleukin-8, which is a powerful neutrophils chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activate a phosphatidylinositol-calcium second messenger system. This receptor binds to IL-8 with a high affinity and to MGSA (GRO) with a low affinity.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab158759 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158759 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158759.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up