Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP25025
    • SpeciesHuman
    • SequenceMEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYF VVIIYALVFLLSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALT LPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIVH ATRTLTQKRYLVKFICLSIWGLSLLLALPVLLFRRTVYSSNVSPACYEDM GNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFKAHMGQKHRAM RVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVG SSSGHTSTTL
    • Molecular weight66 kDa including tags
    • Amino acids1 to 360
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112309 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • C-X-C chemokine receptor type 2
    • CD 182
    • CD182
    • CD182 antigen
    • CDw128b
    • Chemokine (CXC) receptor 2
    • CMKAR2
    • CXC-R2
    • CXCR 2
    • CXCR-2
    • CXCR2
    • CXCR2_HUMAN
    • GRO/MGSA receptor
    • High affinity interleukin-8 receptor B
    • IL 8 receptor type 2
    • IL 8R B
    • IL-8 receptor type 2
    • IL-8R B
    • IL8 RB
    • IL8 receptor type 2
    • IL8R B
    • IL8R2
    • IL8RA
    • Interleukin 8 Receptor B
    • Interleukin 8 receptor, beta
    • Interleukin 8 receptor, type 2
    see all
  • FunctionReceptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Binds to IL-8 with high affinity. Also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.
  • Sequence similaritiesBelongs to the G-protein coupled receptor 1 family.
  • Post-translational
    modifications
    Phosphorylated upon ligand binding; which is required for desensitization.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human CXCR2 protein images

  • ab112309 on a 12% SDS-PAGE stained with coomassie blue

References for Recombinant Human CXCR2 protein (ab112309)

ab112309 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112309.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"