Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYF VVIIYALVFLLSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALT LPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIVH ATRTLTQKRYLVKFICLSIWGLSLLLALPVLLFRRTVYSSNVSPACYEDM GNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFKAHMGQKHRAM RVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVG SSSGHTSTTL
    • Molecular weight
      66 kDa including tags
    • Amino acids
      1 to 360
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112309 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • C-X-C chemokine receptor type 2
    • CD 182
    • CD182
    • CD182 antigen
    • CDw128b
    • Chemokine (CXC) receptor 2
    • CMKAR2
    • CXC-R2
    • CXCR 2
    • CXCR-2
    • CXCR2
    • CXCR2_HUMAN
    • GRO/MGSA receptor
    • High affinity interleukin-8 receptor B
    • IL 8 receptor type 2
    • IL 8R B
    • IL-8 receptor type 2
    • IL-8R B
    • IL8 RB
    • IL8 receptor type 2
    • IL8R B
    • IL8R2
    • IL8RA
    • Interleukin 8 Receptor B
    • Interleukin 8 receptor, beta
    • Interleukin 8 receptor, type 2
    see all
  • Function
    Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Binds to IL-8 with high affinity. Also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Post-translational
    modifications
    Phosphorylated upon ligand binding; which is required for desensitization.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab112309 on a 12% SDS-PAGE stained with coomassie blue

References

ab112309 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112309.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up