Recombinant Human CXCR3 protein (ab112296)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLN FDR
    • Molecular weight
      31 kDa including tags
    • Amino acids
      1 to 53
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112296 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    useful for Antibody Production and Protein Array
  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • C-X-C chemokine receptor type 3
    • CD 183
    • CD182
    • CD183
    • Chemokine (C X C motif) receptor 3
    • Chemokine (C X C) receptor 3
    • Chemokine CXC Motif Receptor 3
    • CKR L2
    • CKR-L2
    • CKRL2
    • CMKAR3
    • CXC-R3
    • CXCR-3
    • CXCR3
    • CXCR3_HUMAN
    • G Protein Coupled Receptor 9
    • G protein-coupled receptor 9
    • GPR9
    • Interferon-inducible protein 10 receptor
    • IP-10 receptor
    • IP10
    • IP10 R
    • IP10 receptor
    • IP10-R
    • IP10R
    • Mig R
    • Mig receptor
    • Mig-R
    • MIGR
    see all
  • Function
    Receptor for CXCL9, CXCL10 and CXCL11 and mediates the proliferation of human mesangial cells (HMC).
    Isoform 2 is a receptor for CXCL4 and also mediates the inhibitory activities of CXCL9, CXCL10 and CXCL11 on the growth of human microvascular endothelial cells (HMVEC). May play a role in angiogenesis.
    Isoform 3 mediates the activity of CXCL11.
  • Tissue specificity
    Isoform 1 and isoform 2 are mainly expressed in heart, kidney, liver and skeletal muscle. Isoform 1 is also expressed in placenta.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human CXCR3 protein images

  • ab112296 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human CXCR3 protein (ab112296)

ab112296 has not yet been referenced specifically in any publications.

Product Wall

Thank youand your customer for confirming these details and for your cooperation.

I am sorry this product did not perform as stated on the datasheet and for the inconvenience this has caused. As requested, I have issued a free of charge repla...

Read More

Thank you and your customerfor taking the time to contact us. I am sorry to hear your customerhas had difficulty obtaining satisfactory results from this product.

The details your customerhas kindly provided will provide us with vital inform...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up