Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP49682
    • SpeciesHuman
    • SequenceSGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPPARVTL TCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQVGRTALRVLQL
    • Molecular weight37 kDa
    • Amino acids121 to 220

Specifications

Our Abpromise guarantee covers the use of ab114323 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C-X-C chemokine receptor type 3
    • CD 183
    • CD182
    • CD183
    • Chemokine (C X C motif) receptor 3
    • Chemokine (C X C) receptor 3
    • Chemokine CXC Motif Receptor 3
    • CKR L2
    • CKR-L2
    • CKRL2
    • CMKAR3
    • CXC-R3
    • CXCR-3
    • CXCR3
    • CXCR3_HUMAN
    • G Protein Coupled Receptor 9
    • G protein-coupled receptor 9
    • GPR9
    • Interferon-inducible protein 10 receptor
    • IP-10 receptor
    • IP10
    • IP10 R
    • IP10 receptor
    • IP10-R
    • IP10R
    • Mig R
    • Mig receptor
    • Mig-R
    • MIGR
    see all
  • FunctionReceptor for CXCL9, CXCL10 and CXCL11 and mediates the proliferation of human mesangial cells (HMC).
    Isoform 2 is a receptor for CXCL4 and also mediates the inhibitory activities of CXCL9, CXCL10 and CXCL11 on the growth of human microvascular endothelial cells (HMVEC). May play a role in angiogenesis.
    Isoform 3 mediates the activity of CXCL11.
  • Tissue specificityIsoform 1 and isoform 2 are mainly expressed in heart, kidney, liver and skeletal muscle. Isoform 1 is also expressed in placenta.
  • Sequence similaritiesBelongs to the G-protein coupled receptor 1 family.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human CXCR3 protein images

  • SDS-PAGE analysis of ab114323 on a 12.5% gel stained with Coomassie Blue.

References for Recombinant Human CXCR3 protein (ab114323)

ab114323 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114323.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"